[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0923
DDBJ      :CPE0923      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:137 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->54 PF00518 * E6 0.00095 31.7 41/110  
:REPEAT 2|9->32|38->61

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80629.1 GT:GENE CPE0923 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1122654..1123067 GB:FROM 1122654 GB:TO 1123067 GB:DIRECTION + GB:GENE CPE0923 GB:PRODUCT hypothetical protein GB:NOTE 137 aa, no significant homology. GB:PROTEIN_ID BAB80629.1 LENGTH 137 SQ:AASEQ MEKSNVFSNDEIIRCTVCGKDLMEDIKMSMVQIITDENDEIVRVIPCCKGKCDQILQDEIKESEGNGFRDLITFVNPYLYINNIMQMMDRMFEGKGFANQEAFNAYSDLILNCYQYVSRNLSEEEKEFSKNISLLPL GT:EXON 1|1-137:0| NREPEAT 1 REPEAT 2|9->32|38->61| HM:PFM:NREP 1 HM:PFM:REP 10->54|PF00518|0.00095|31.7|41/110|E6| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 123-127| PSIPRED cccccccccccEEEEccccHHHHHHHHHHHHHEEEcccccEEEEEEcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //