[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0928
DDBJ      :CPE0928      two-component response regulator
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  822/915 : Eukaryota  48/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1c.23.1
:250 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->118 1tmyA PDBj 2e-17 34.2 %
:BLT:PDB   151->248 2k9sA PDBj 1e-14 35.7 %
:RPS:PDB   1->56 2dvyD PDBj 2e-08 11.1 %
:RPS:PDB   29->118 3cwoX PDBj 1e-23 32.2 %
:RPS:PDB   147->249 1bl0A PDBj 4e-29 29.1 %
:RPS:SCOP  4->122 1a0oA  c.23.1.1 * 2e-22 28.0 %
:RPS:SCOP  126->249 1v4aA1  a.24.16.4 * 3e-23 10.8 %
:HMM:SCOP  1->120 1s8nA_ c.23.1.1 * 7.3e-32 34.2 %
:HMM:SCOP  147->198 1d5yA1 a.4.1.8 * 4.4e-09 40.4 %
:HMM:SCOP  201->250 1d5yA2 a.4.1.8 * 2.5e-12 42.0 %
:RPS:PFM   4->115 PF00072 * Response_reg 9e-18 40.0 %
:RPS:PFM   166->197 PF00165 * HTH_AraC 5e-04 53.1 %
:RPS:PFM   217->248 PF00165 * HTH_AraC 5e-04 43.8 %
:HMM:PFM   4->115 PF00072 * Response_reg 1.8e-30 38.7 111/112  
:HMM:PFM   159->199 PF00165 * HTH_AraC 3.2e-11 36.6 41/42  
:HMM:PFM   212->248 PF00165 * HTH_AraC 2.2e-10 41.7 36/42  
:BLT:SWISS 1->250 Y2406_STAEQ 6e-24 26.8 %
:PROS 202->244|PS00041|HTH_ARAC_FAMILY_1
:REPEAT 2|148->193|200->243

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80634.1 GT:GENE CPE0928 GT:PRODUCT two-component response regulator GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1126690..1127442 GB:FROM 1126690 GB:TO 1127442 GB:DIRECTION + GB:GENE CPE0928 GB:PRODUCT two-component response regulator GB:NOTE 250 aa, similar to gpu:AP001519_194 two-component response regulator from Bacillus halodurans (257 aa); 30.8% identity in 247 aa overlap GB:PROTEIN_ID BAB80634.1 LENGTH 250 SQ:AASEQ MFSIMVADDEQLERRVLTSILKKNVRVKEIIEAKNGKEALELNREFNPDIIIMDIKMPGINGIKALELIKNENPNKEIIMLTAYDDFEFIHKVLVLGGSDYIIKPIKPDKLMEIVDNIMDKIENKNIELGVKSHSDEKTLDRNLTNEEKIVDKVSKYIDDNMDKMLKLEELASICNLSPGYFSRVFKKETGKTVITYINEKKVERAKKLLKESKDPIINISLDLGFDDCGYFIRVFKKITGLTPKAFREE GT:EXON 1|1-250:0| BL:SWS:NREP 1 BL:SWS:REP 1->250|Y2406_STAEQ|6e-24|26.8|246/251| PROS 202->244|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| NREPEAT 1 REPEAT 2|148->193|200->243| BL:PDB:NREP 2 BL:PDB:REP 4->118|1tmyA|2e-17|34.2|114/118| BL:PDB:REP 151->248|2k9sA|1e-14|35.7|98/107| RP:PDB:NREP 3 RP:PDB:REP 1->56|2dvyD|2e-08|11.1|54/214| RP:PDB:REP 29->118|3cwoX|1e-23|32.2|90/236| RP:PDB:REP 147->249|1bl0A|4e-29|29.1|103/116| RP:PFM:NREP 3 RP:PFM:REP 4->115|PF00072|9e-18|40.0|110/111|Response_reg| RP:PFM:REP 166->197|PF00165|5e-04|53.1|32/40|HTH_AraC| RP:PFM:REP 217->248|PF00165|5e-04|43.8|32/40|HTH_AraC| HM:PFM:NREP 3 HM:PFM:REP 4->115|PF00072|1.8e-30|38.7|111/112|Response_reg| HM:PFM:REP 159->199|PF00165|3.2e-11|36.6|41/42|HTH_AraC| HM:PFM:REP 212->248|PF00165|2.2e-10|41.7|36/42|HTH_AraC| GO:PFM:NREP 11 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00165|IPR000005| GO:PFM GO:0005622|"GO:intracellular"|PF00165|IPR000005| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00165|IPR000005| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00165|IPR000005| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00165|IPR000005| GO:PFM GO:0005622|"GO:intracellular"|PF00165|IPR000005| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00165|IPR000005| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00165|IPR000005| RP:SCP:NREP 2 RP:SCP:REP 4->122|1a0oA|2e-22|28.0|118/128|c.23.1.1| RP:SCP:REP 126->249|1v4aA1|3e-23|10.8|120/151|a.24.16.4| HM:SCP:REP 1->120|1s8nA_|7.3e-32|34.2|117/190|c.23.1.1|1/1|CheY-like| HM:SCP:REP 147->198|1d5yA1|4.4e-09|40.4|52/54|a.4.1.8|1/2|Homeodomain-like| HM:SCP:REP 201->250|1d5yA2|2.5e-12|42.0|50/0|a.4.1.8|2/2|Homeodomain-like| OP:NHOMO 8226 OP:NHOMOORG 899 OP:PATTERN -----------------------93112-314---2--3333245-3B14726-2-2122-------2 ALM2Q52433241473423-371146333333A8699C9A774D9B4344557961471167A6G69OPM3533374413326-4955LMnZ-O111--98V8CD*Dg8e----------11111---731222C5GEEMIB8BO9XDGEAA338333233229D59KMUA211212112222453225527BNOOPPPLNSDSNQONJWYPOILRUSEIHXCBCDCBCCEo*66666664666666676664B2-1221-2143444222451472339999555A88455455555555766557656666A553335555KYJNvMLMRQQQGNEUHFFBDHCjEM46CFIB7SQRHDFCF8BC9BO245EOE6334-----A8D751128578322222222225-552461454731E887A79CE7DG623434431-11584222222221--13E35111-211111112111-23222221-----12612-2115A998BB9555488LK77773A9AF9BBA-1566F4432865C927A3896C42112221212497FCceSADXH3XUFFF3halSRUgFICBFEGKHQL244111111--1-------DJ74A--FFDHCME5HEABBBCCA9DBBABB9AFBHM--25A77------FC898A9HGGIHGGGHG-GHGGHIJGFGGHIGHHFGCFGE67986IHDFIIHFFHFGHGFFDFDCEECG--B998AA979A9A--4A11121222336Q4J422314-3233-221AABAA673649CEEEEAFBJIB9DDCAAD11-1-11-16CEECFDFDDHKHJJ6798988556333311F2BB78AA2222222271--------------------------51454636564M2 ----42-------211-------1-1----------------------11111111111111-22----1--2-2------22222----------1--111-------1-----------------------------------------------------2---------2------111-1K115-2---2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 249 STR:RPRED 99.6 SQ:SECSTR cEEEEEEcccHHHHHHHHHHHHHHccEEEEEccccccTTHHHHHHHccccEEEEcccTTccHHHHHHHHHHHcccccEEEEccccTHHHHHHHHHTTccEEEEcHHHHHcTHHHHHHHHcTcHHHccccEEEEEccTTcccHHccccHHHHHHHHHHHHTTTTcccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHHT# DISOP:02AL 246-250| PSIPRED ccEEEEEEccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHcc //