[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0930
DDBJ      :CPE0930      coenzyme B12-dependent glycerol dehydrogenase medium subunit
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.51.3
:190 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->188 1mmfE PDBj 3e-54 67.8 %
:RPS:PDB   16->188 1eexB PDBj 2e-56 52.0 %
:RPS:SCOP  16->190 1dioB  c.51.3.1 * 1e-29 51.4 %
:HMM:SCOP  10->190 1iwpB_ c.51.3.1 * 4.9e-77 63.5 %
:RPS:PFM   16->186 PF02288 * Dehydratase_MU 3e-48 64.1 %
:HMM:PFM   15->188 PF02288 * Dehydratase_MU 9e-93 77.0 174/175  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80636.1 GT:GENE CPE0930 GT:PRODUCT coenzyme B12-dependent glycerol dehydrogenase medium subunit GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1129452..1130024 GB:FROM 1129452 GB:TO 1130024 GB:DIRECTION + GB:GENE CPE0930 GB:PRODUCT coenzyme B12-dependent glycerol dehydrogenase medium subunit GB:NOTE 190 aa, similar to prf:2222228B coenzyme B12-dependent glycerol dehydratase from Citrobacter freundii (194 aa); 60.9% identity in 184 aa overlap GB:PROTEIN_ID BAB80636.1 LENGTH 190 SQ:AASEQ MTMEERTFIPEITVEEVGEAKVGLRSDEVVIGLAPAFLKYQNKTIVDVPHTETLLEIIAGIEEEGLHARVVRILRTSDVSFIAHDAACLSGSGIGIGIQSKGTTVIHQKDLLPLNNLELFSQAPLLTTETYRLIGKNAAKYAKGESPTPVPVKNDQMVRPKFMAKAALLHIKETKHVEPGKKPVQLEVKF GT:EXON 1|1-190:0| SEG 51->66|tetlleiiagieeegl| SEG 90->102|sgsgigigiqskg| BL:PDB:NREP 1 BL:PDB:REP 12->188|1mmfE|3e-54|67.8|177/184| RP:PDB:NREP 1 RP:PDB:REP 16->188|1eexB|2e-56|52.0|173/178| RP:PFM:NREP 1 RP:PFM:REP 16->186|PF02288|3e-48|64.1|170/173|Dehydratase_MU| HM:PFM:NREP 1 HM:PFM:REP 15->188|PF02288|9e-93|77.0|174/175|Dehydratase_MU| RP:SCP:NREP 1 RP:SCP:REP 16->190|1dioB|1e-29|51.4|175/179|c.51.3.1| HM:SCP:REP 10->190|1iwpB_|4.9e-77|63.5|181/184|c.51.3.1|1/1|B12-dependent dehydatase associated subunit| OP:NHOMO 56 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- ---------------------1---3------1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111------------------------1----------11---------------------------------------------1---------------------1-1-----111--------------------1----------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------1----------------------------------------1--------------1-------1------1-----1222-----1111111111111111-------1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 94.2 SQ:SECSTR ###########EEEcEEEEccccccccEEEEEEcTTcTTTccccTTcccHHHHHHHHHHHHHHTTcEEEEEEccccccHHHHHHHHHHHcTTcEEEEEcTTccEEEEETTccTTcccEEEccGGGccHHHHHHHHHHHHHHHTTcccccccccccTTHHHHHHHHHHHHHHHHHTTccTTcccEEEEEcc DISOP:02AL 1-11| PSIPRED cccccccEEEEEEEEEccccccccccccEEEEEccHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEEEEEccEEEEEEHHHcccccEEEEEEccccEEEEEEccccccccccccccccEEEHHHHHHHHHHHHHHHHcccccccEEEccccccHHHHHHHHHHHHHHccEEEccccccEEEEEc //