[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0933
DDBJ      :CPE0933      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.51.3
:116 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   58->113 1nbwB PDBj 8e-08 41.1 %
:RPS:PDB   8->111 1eexB PDBj 4e-15 21.6 %
:RPS:SCOP  38->116 1nbwB  c.51.3.2 * 3e-22 36.7 %
:HMM:SCOP  1->116 1iwpB_ c.51.3.1 * 2.4e-31 41.6 %
:HMM:PFM   18->111 PF02288 * Dehydratase_MU 3.1e-07 35.6 90/175  
:BLT:SWISS 62->116 YDHX_CITFR 2e-07 40.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80639.1 GT:GENE CPE0933 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1132329..1132679 GB:FROM 1132329 GB:TO 1132679 GB:DIRECTION + GB:GENE CPE0933 GB:PRODUCT conserved hypothetical protein GB:NOTE 116 aa, similar to sp:YDHX_CITFR HYPOTHETICAL 12.5 KDA PROTEIN IN DHAR-DHAT INTERGENIC REGION (ORFX) from Citrobacter freundii (117 aa); 40.5% identity in 74 aa overlap GB:PROTEIN_ID BAB80639.1 LENGTH 116 SQ:AASEQ MIKDYNHPSIFVYCSLGINEVDIEEILWGIEEEGIPFILKNKDLNDAKELANLAANDSKLSVGIGVNSKGDVSLTINKLKEEEPLFFINLEEGNTCLRSLGANGARLVKGMPLKNI GT:EXON 1|1-116:0| BL:SWS:NREP 1 BL:SWS:REP 62->116|YDHX_CITFR|2e-07|40.0|55/117| SEG 23->35|ieeilwgieeegi| BL:PDB:NREP 1 BL:PDB:REP 58->113|1nbwB|8e-08|41.1|56/113| RP:PDB:NREP 1 RP:PDB:REP 8->111|1eexB|4e-15|21.6|97/178| HM:PFM:NREP 1 HM:PFM:REP 18->111|PF02288|3.1e-07|35.6|90/175|Dehydratase_MU| RP:SCP:NREP 1 RP:SCP:REP 38->116|1nbwB|3e-22|36.7|79/113|c.51.3.2| HM:SCP:REP 1->116|1iwpB_|2.4e-31|41.6|113/184|c.51.3.1|1/1|B12-dependent dehydatase associated subunit| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 108 STR:RPRED 93.1 SQ:SECSTR #######TTcTTTccccTTcccHHHHHHHHHHHHHEEEEEccccccHHHHHHHHHHHcTTcEEEEEcTTccEEEEEEEETTccTTcGccHHHcGGGHHHHHHHHHHHHTTccccc# DISOP:02AL 1-5| PSIPRED ccccccccEEEEEEEccccHHHHHHHHHccccccccEEEEEcccccHHHHHHHHHHccccEEEEEEcccccEEEEEcccccccccEEEcccccHHHHHHHccccEEEEEccccccc //