[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0938
DDBJ      :CPE0938      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:224 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   68->182 PF01794 * Ferric_reduct 2.6e-13 20.2 114/125  
:BLT:SWISS 5->216 Y572_TREPA 1e-14 31.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80644.1 GT:GENE CPE0938 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1137256..1137930 GB:FROM 1137256 GB:TO 1137930 GB:DIRECTION + GB:GENE CPE0938 GB:PRODUCT hypothetical protein GB:NOTE 224 aa, similar to pir:B71309 hypothetical protein TP0572 from Treponema pallidum (360 aa); 33.3% identity in 120 aa overlap. Putative N-terminal signal sequence and 5 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80644.1 LENGTH 224 SQ:AASEQ MEYLIYSLIAVIILTVGLNNIFKKQSKYFYMLATLISVVVTSYEIFKIWTGFKLEGIIFVLERSFMKGFVSTALFILVMFAGALSKKWGITKKLLRVRAEMAILASILILPHFIIYTYKFLVRLFSGKPLSILYISFIIVGLIAFIIMIPLFITSFKKVRVTMSPSKWKMVQRWAYPFYFLVYLHIILILFNKKVFNLNAVILYTVIFLGYFILRICNNKKAIK GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 5->216|Y572_TREPA|1e-14|31.4|207/360| TM:NTM 6 TM:REGION 1->22| TM:REGION 25->47| TM:REGION 64->85| TM:REGION 98->120| TM:REGION 133->155| TM:REGION 185->207| HM:PFM:NREP 1 HM:PFM:REP 68->182|PF01794|2.6e-13|20.2|114/125|Ferric_reduct| OP:NHOMO 21 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------134----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21-------1-------121-1--1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1--------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 221-224| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc //