[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0945
DDBJ      :CPE0945      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.80.8
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->130 2f3lA PDBj 2e-04 25.5 %
:RPS:PDB   14->114 2bm5A PDBj 2e-12 14.9 %
:RPS:SCOP  14->114 2bm4A1  b.80.8.1 * 4e-14 14.9 %
:HMM:SCOP  6->116 2bm5A1 b.80.8.1 * 2.6e-19 19.8 %
:HMM:PFM   20->54 PF00805 * Pentapeptide 1.6e-08 25.7 35/40  
:HMM:PFM   41->79 PF00805 * Pentapeptide 7.7e-09 25.6 39/40  
:HMM:PFM   78->108 PF00805 * Pentapeptide 3.9e-08 19.4 31/40  
:BLT:SWISS 32->128 SPKB_SYNY3 1e-04 27.0 %
:BLT:SWISS 121->187 RUVX_HELPJ 5e-04 37.9 %
:REPEAT 2|22->38|42->58
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80651.1 GT:GENE CPE0945 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1142621..1143277) GB:FROM 1142621 GB:TO 1143277 GB:DIRECTION - GB:GENE CPE0945 GB:PRODUCT hypothetical protein GB:NOTE 218 aa, no significant homology. S.D. unclear. GB:PROTEIN_ID BAB80651.1 LENGTH 218 SQ:AASEQ MTQTQKNTQIFKYNKAEKRNKNFMYMDFRRGNCYNCDFSCSNFSYASFRGAHFKSCDFFECKFDSTEFIGSNLKKSKFKKSKFKNVIFEGVNLDGVDFSGATFENVIFINSDISKTSGMKFKEDEVKIYEDMPSFEISDSLKEAALKALENNYIKKSRVLDTKEGDLNTLSLIRLLENHKENMLREGLKLSAEKIDRDFCTLSYIDKSITKLKNEGLL GT:EXON 1|1-218:0| BL:SWS:NREP 2 BL:SWS:REP 32->128|SPKB_SYNY3|1e-04|27.0|89/574| BL:SWS:REP 121->187|RUVX_HELPJ|5e-04|37.9|58/134| NREPEAT 1 REPEAT 2|22->38|42->58| SEG 74->84|kkskfkkskfk| BL:PDB:NREP 1 BL:PDB:REP 37->130|2f3lA|2e-04|25.5|94/130| RP:PDB:NREP 1 RP:PDB:REP 14->114|2bm5A|2e-12|14.9|101/183| HM:PFM:NREP 3 HM:PFM:REP 20->54|PF00805|1.6e-08|25.7|35/40|Pentapeptide| HM:PFM:REP 41->79|PF00805|7.7e-09|25.6|39/40|Pentapeptide| HM:PFM:REP 78->108|PF00805|3.9e-08|19.4|31/40|Pentapeptide| RP:SCP:NREP 1 RP:SCP:REP 14->114|2bm4A1|4e-14|14.9|101/180|b.80.8.1| HM:SCP:REP 6->116|2bm5A1|2.6e-19|19.8|111/0|b.80.8.1|1/1|Pentapeptide repeat-like| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------1-1-----111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 118 STR:RPRED 54.1 SQ:SECSTR ############ETTcEEEEEEcTTcEEEcccccccEEEEEEcTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTcccTTccccHHHHHHcccTTccTcccTTcEEcHHH######################################################################################## DISOP:02AL 217-218| PSIPRED ccHHHHHHHHHccccccccccccccccccccEEEcccccccccccccccccEEEccEEEccccccccccccccccccccccccccccccccEEEcccccccEEEccEEccccccccEEcccccccccHHHHHHccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccHHHHHHHHcccccHHHcccHHHHHHHHHHHHccccccc //