[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0949
DDBJ      :CPE0949      probable ABC transporter
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  903/915 : Eukaryota  183/199 : Viruses  1/175   --->[See Alignment]
c.37.1
:306 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   4->210 3dhwC PDBj 3e-20 29.6 %
:RPS:PDB   1->209 3cmvH PDBj 3e-30 14.3 %
:RPS:SCOP  3->209 1sgwA  c.37.1.12 * 2e-33 22.2 %
:HMM:SCOP  7->213 1ii8.1 c.37.1.12 * 1.4e-56 39.2 %
:RPS:PFM   20->91 PF03193 * DUF258 3e-04 40.8 %
:HMM:PFM   44->161 PF00005 * ABC_tran 2.8e-22 40.0 115/118  
:HMM:PFM   21->52 PF02367 * UPF0079 2e-05 43.8 32/123  
:BLT:SWISS 1->302 BCRA_BACLI 2e-65 42.7 %
:PROS 133->147|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80655.1 GT:GENE CPE0949 GT:PRODUCT probable ABC transporter GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1147720..1148640 GB:FROM 1147720 GB:TO 1148640 GB:DIRECTION + GB:GENE CPE0949 GB:PRODUCT probable ABC transporter GB:NOTE 306 aa, similar to sp:BCRA_BACLI BACITRACIN TRANSPORT ATP-BINDING PROTEIN BCRA from Bacillus licheniformis (306 aa); 42.4% identity in 302 aa overlap ATP-binding protein GB:PROTEIN_ID BAB80655.1 LENGTH 306 SQ:AASEQ MGNIISIRNLNKNYGKKNILDNLSMNLKKGDIYGLVGKNGAGKTTLIRIILSLANYDSGEIELFGEIDEKKKLYEHKKIGNIIETPSFYSFLTAKQNLEYYKIQRGIVGEKSIDEILEMVGLGDVGNKKFKKFSLGMKQRLGLALALLGEPELLILDEPTNGMDPMGIKEVREVLINLNKKNGVTILVSSHILGELSQLANCYGFLKDGKIIEEISSEELNEKCRNHLLIKVDDCKKAAVILERVLDNNSYEVLPDRFIKIYNKLDEPQLINRALVENGVEVYSLERIGVNLEDYFVDLIGGEYNA GT:EXON 1|1-306:0| BL:SWS:NREP 1 BL:SWS:REP 1->302|BCRA_BACLI|2e-65|42.7|302/306| PROS 133->147|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 141->156|lglalallgepellil| SEG 211->219|iieeissee| BL:PDB:NREP 1 BL:PDB:REP 4->210|3dhwC|3e-20|29.6|206/343| RP:PDB:NREP 1 RP:PDB:REP 1->209|3cmvH|3e-30|14.3|203/1173| RP:PFM:NREP 1 RP:PFM:REP 20->91|PF03193|3e-04|40.8|71/160|DUF258| HM:PFM:NREP 2 HM:PFM:REP 44->161|PF00005|2.8e-22|40.0|115/118|ABC_tran| HM:PFM:REP 21->52|PF02367|2e-05|43.8|32/123|UPF0079| GO:PFM:NREP 2 GO:PFM GO:0003924|"GO:GTPase activity"|PF03193|IPR004881| GO:PFM GO:0005525|"GO:GTP binding"|PF03193|IPR004881| RP:SCP:NREP 1 RP:SCP:REP 3->209|1sgwA|2e-33|22.2|198/200|c.37.1.12| HM:SCP:REP 7->213|1ii8.1|1.4e-56|39.2|204/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 26327 OP:NHOMOORG 1155 OP:PATTERN JID7ICBFNNOMLJOIT9FGDDDPXCGNOLRMC8B9B9FFDEBKQCONEMpeT7HUINQGJDDAM137 IMbDyHILNNNJJJHGFCC-CP55HlCCCCCBUWVXVpnqEWDVQcKPPHEDcZSBBJ68QVXFcTWupuHKDCCYLMNBVHS76778KKID3D8B9--CDKEIERHMHI344444468977777ED9FH89ECKDTSRYYDDAeJORQMNNONMBCA595A6IREQUWUFDA5698A9B87ALJHFDST7DVm********p*******nqqio***VVYxoOefhigfc**TVWXVXTUUUVVVTTNWSRNfNNOfeNFQLSfeHHjlSNKRaXSWVcZbfdagZfeabaZaYbbZZZRRRRPSSTSSSRQcSTPOQVUWba*ox********h*di*vvXacY*ibggdZhJC**OTLTZUQObQibFWULIWJIID9DBBCMH***HBQgXXcXmnfimdmgig*-JLVIFWIMh*E6************wcA9EYe*bachmcoHHHHHHHHLAC89LIV45344444442233444333333345454D88999UhbSXfjlimiNRRSPiixzWTUVKZki*WejV6EVVOXOTNMZamht*IOKAHACLGDDCCCBBFIGGOOTbuBLHUNDKaJJKCMKLGIIRJIHHEJYUMPGGDJCGFFIEC587877877AFB9BA8RQcCRNMDKBYEGHJIDJOIIIJGJJIMKL2-5AB6G-1----XVmlJbOUVVUUWTVQR-USUSUTTRRSVVRQQTQQWlunmmLIMOMNNMONNNNONPNNNfOMKPQOPC2UYacbbbcbbcb239CAC9ACEEEEGAbOmONNOIQCEHDCIIKMCCEDD7F69EJMSUURWijpWWbUZTnkkA99798A89DLRPZQSRSSYaYTSGFCCBCCBCCA78734BQGGHIEF57667677f4J84668-8988A86IHE89D494445NcZKNSjUYR9ID 1---EE5-MB269F8213211111-1133111111111-1--12112122123211211121222112212211312122-32245---2331211111-1-2-33-43EB9CDHBD87736A9RR5P4X*H3IANA875H55GB7B764K65q6FEAN59U8D9M4IEHc5AB76453Z32464D78D1EC34MCED6 ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--- DISOP:02AL 303-306| PSIPRED ccccEEEEccEEEEccEEEEEcccEEEcccEEEEEEccccccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHccEEEccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHcccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHEEEEEccEEEEEccHHHHHHHccccEEEEEccccHHHHHHHHHcccccEEEEcccEEEEEEccccHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHcccccc //