[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0952
DDBJ      :CPE0952      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:75 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->62 PF09358 * UBA_e1_C 4.5e-05 18.8 32/125  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80658.1 GT:GENE CPE0952 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1150404..1150631) GB:FROM 1150404 GB:TO 1150631 GB:DIRECTION - GB:GENE CPE0952 GB:PRODUCT hypothetical protein GB:NOTE 75 aa, no significant homology. GB:PROTEIN_ID BAB80658.1 LENGTH 75 SQ:AASEQ MNSILPQAVNLLSYINSGETFIIKDLFPKIIWDKLSYTEKRTLESAFLKHINKKFDLRIKALNEIREGLKVYEKL GT:EXON 1|1-75:0| HM:PFM:NREP 1 HM:PFM:REP 30->62|PF09358|4.5e-05|18.8|32/125|UBA_e1_C| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcc //