[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0956
DDBJ      :CPE0956      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   48->138 PF04307 * DUF457 7e-05 31.8 %
:HMM:PFM   47->138 PF04307 * DUF457 5.8e-23 49.3 69/77  
:BLT:SWISS 50->145 YDJM_SHIFL 7e-09 31.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80662.1 GT:GENE CPE0956 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1154306..1154896) GB:FROM 1154306 GB:TO 1154896 GB:DIRECTION - GB:GENE CPE0956 GB:PRODUCT conserved hypothetical protein GB:NOTE 196 aa, similar to gp:AB004104_2 ORF10291-2 from Clostridium perfringens (196 aa); 72.4% identity in 196 aa overlap. Putative N-terminal signal sequence and 4 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80662.1 LENGTH 196 SQ:AASEQ MTKETHSTGGVCISLIMLNTILSLFLFPYDIAYKILLIALFFHFSYIGSLFPDIDQRKSSISQMYPFLSKHIGSKCRHRGFTHSLLCLSLIVLTLYIILNVSNFNIILLIISIGFIAGYISHLVLDFLTSEGIELFYPWKTNFKIAKIKTGSKTEKIINKILKIFNFLLIIYNIVLILSDILGINILSFISKSTLF GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 50->145|YDJM_SHIFL|7e-09|31.9|94/200| TM:NTM 5 TM:REGION 10->32| TM:REGION 34->56| TM:REGION 81->103| TM:REGION 108->130| TM:REGION 165->187| SEG 85->95|llclslivltl| SEG 97->116|iilnvsnfniilliisigfi| SEG 156->178|kiinkilkifnflliiynivlil| RP:PFM:NREP 1 RP:PFM:REP 48->138|PF04307|7e-05|31.8|88/99|DUF457| HM:PFM:NREP 1 HM:PFM:REP 47->138|PF04307|5.8e-23|49.3|69/77|DUF457| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //