[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0957
DDBJ      :CPE0957      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:72 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->70 PF01901 * DUF70 0.00073 24.6 65/332  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80663.1 GT:GENE CPE0957 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1155088..1155306) GB:FROM 1155088 GB:TO 1155306 GB:DIRECTION - GB:GENE CPE0957 GB:PRODUCT hypothetical protein GB:NOTE 72 aa, no significant homology. Putative N-terminal signal sequence and 1 putative transmembrane region were found by PSORT GB:PROTEIN_ID BAB80663.1 LENGTH 72 SQ:AASEQ MKHTKRILTSAILITLITLFSPLILKNSIALYIEQRVSYFTSLEVVSNIISPILALISIFSIAYSIIVIKNK GT:EXON 1|1-72:0| TM:NTM 2 TM:REGION 7->29| TM:REGION 46->68| SEG 7->19|iltsailitlitl| HM:PFM:NREP 1 HM:PFM:REP 5->70|PF01901|0.00073|24.6|65/332|DUF70| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcc //