[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0962
DDBJ      :CPE0962      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:319 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   219->306 PF04982 * HPP 1.8e-05 18.1 83/121  
:HMM:PFM   140->177 PF01166 * TSC22 0.0003 47.2 36/60  
:BLT:SWISS 174->259 YDJE_ECOLI 7e-04 30.5 %
:TM
:REPEAT 2|4->139|165->310
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80668.1 GT:GENE CPE0962 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1158113..1159072 GB:FROM 1158113 GB:TO 1159072 GB:DIRECTION + GB:GENE CPE0962 GB:PRODUCT hypothetical protein GB:NOTE 319 aa, no significant homology. Putative N-terminal signal sequence and 11 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80668.1 LENGTH 319 SQ:AASEQ MKYKRYFISLVLILAMVSIAEITGEREIIFPEVAALVVGSWVLEKQPWKVSKLGLVCLMTLCSIVGVLIVRYVNLGLTIEVLIGLVFTGLILKLSKTTLVPIISACILPIVLRTETWVYPISVFILTILIVSIKYFIEDYGVSEEVREELKEEITKLERNTSLRKKEFIRLLKIFITVGILTYFSVKFNITLLIAPPLIVAFIELTNEHCKFRQRSKSLLFLFIVVAILGFIFRIGFNEYLGLPLWLCTIFLLISLFICLEIFNMYFPPVAAIAVLPMLLTSKQVMFYPFQIAIGCLIFITIAMIFFKEEKCIVDTFKN GT:EXON 1|1-319:0| BL:SWS:NREP 1 BL:SWS:REP 174->259|YDJE_ECOLI|7e-04|30.5|82/100| TM:NTM 7 TM:REGION 6->28| TM:REGION 60->82| TM:REGION 107->129| TM:REGION 176->198| TM:REGION 217->239| TM:REGION 252->274| TM:REGION 288->310| NREPEAT 1 REPEAT 2|4->139|165->310| SEG 144->153|eevreelkee| HM:PFM:NREP 2 HM:PFM:REP 219->306|PF04982|1.8e-05|18.1|83/121|HPP| HM:PFM:REP 140->177|PF01166|0.0003|47.2|36/60|TSC22| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------11111--1---11----------1--------------1----------------------1---------------------------------------------------------------------------------1-----111---------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------1-------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccEEHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHHHcccHHHHccccc //