[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0980
DDBJ      :CPE0980      probable transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  210/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1b.82.1b.82.4
:272 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   167->272 1ti9A PDBj 1e-07 19.8 %
:RPS:PDB   31->88 2b8mA PDBj 1e-07 15.5 %
:RPS:PDB   173->268 1bl0A PDBj 6e-23 19.8 %
:RPS:SCOP  4->83 1sq4A  b.82.1.11 * 8e-08 6.3 %
:RPS:SCOP  173->268 1v4aA1  a.24.16.4 * 1e-19 6.2 %
:HMM:SCOP  8->154 2arcA_ b.82.4.1 * 5e-12 21.8 %
:HMM:SCOP  169->220 1d5yA1 a.4.1.8 * 2.8e-07 25.0 %
:HMM:SCOP  223->270 1d5yA2 a.4.1.8 * 3e-08 39.6 %
:RPS:PFM   232->271 PF00165 * HTH_AraC 6e-04 37.5 %
:HMM:PFM   180->220 PF00165 * HTH_AraC 4e-09 39.0 41/42  
:HMM:PFM   236->268 PF00165 * HTH_AraC 6.4e-09 43.8 32/42  
:HMM:PFM   28->145 PF02311 * AraC_binding 5e-15 18.6 118/136  
:BLT:SWISS 173->268 Y161_STAAB 5e-13 33.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80686.1 GT:GENE CPE0980 GT:PRODUCT probable transcriptional regulator GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1180337..1181155) GB:FROM 1180337 GB:TO 1181155 GB:DIRECTION - GB:GENE CPE0980 GB:PRODUCT probable transcriptional regulator GB:NOTE 272 aa, similar to gpu:AF206272_3 transcriptional regulator from Streptococcus mutans (301 aa); 25.2% identity in 266 aa overlap AraC/XylS family GB:PROTEIN_ID BAB80686.1 LENGTH 272 SQ:AASEQ MSNYIYENHFHSDPNFPVIFHCDILNKNRPSFLMHYHENIELLYFLDGHAKVVCDNKILQAKADDIIIINSKELHSIEKISDSCKYYCLIIDKDLLNDNLNDFDNFRFKNLVKDSFLKTKIEEINRELNNKNDYFKEFIKSDILQILIHIKRNHAQKNSSLIKIKDNNKILMVREIINYLKENYKEEISIDHICNHVAFSKYYTCRTFKEVTGQTILDHINHIRCINARNLILYNGYTISESAYKSGFNNLSYFSKTYKKYMGLLPSEEKIT GT:EXON 1|1-272:0| BL:SWS:NREP 1 BL:SWS:REP 173->268|Y161_STAAB|5e-13|33.7|95/252| SEG 89->111|liidkdllndnlndfdnfrfknl| BL:PDB:NREP 1 BL:PDB:REP 167->272|1ti9A|1e-07|19.8|106/129| RP:PDB:NREP 2 RP:PDB:REP 31->88|2b8mA|1e-07|15.5|58/105| RP:PDB:REP 173->268|1bl0A|6e-23|19.8|96/116| RP:PFM:NREP 1 RP:PFM:REP 232->271|PF00165|6e-04|37.5|40/40|HTH_AraC| HM:PFM:NREP 3 HM:PFM:REP 180->220|PF00165|4e-09|39.0|41/42|HTH_AraC| HM:PFM:REP 236->268|PF00165|6.4e-09|43.8|32/42|HTH_AraC| HM:PFM:REP 28->145|PF02311|5e-15|18.6|118/136|AraC_binding| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00165|IPR000005| GO:PFM GO:0005622|"GO:intracellular"|PF00165|IPR000005| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00165|IPR000005| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00165|IPR000005| RP:SCP:NREP 2 RP:SCP:REP 4->83|1sq4A|8e-08|6.3|79/270|b.82.1.11| RP:SCP:REP 173->268|1v4aA1|1e-19|6.2|96/151|a.24.16.4| HM:SCP:REP 8->154|2arcA_|5e-12|21.8|147/0|b.82.4.1|1/1|Regulatory protein AraC| HM:SCP:REP 169->220|1d5yA1|2.8e-07|25.0|52/54|a.4.1.8|1/2|Homeodomain-like| HM:SCP:REP 223->270|1d5yA2|3e-08|39.6|48/0|a.4.1.8|1/1|Homeodomain-like| OP:NHOMO 509 OP:NHOMOORG 212 OP:PATTERN -------------------------------------------------------------------- --1--------------------------------------------------------------------2----------------3467-5--1----8123512-6---------------------------------------------------------11-------------------11--1-11211212-1122318722--11313251--3333345o-11111111111111-111-3---------122--11--1------1114111111-----------111111111111111----11116644D3333333635E5441564L15---57--21----1--22-1A-----1----------------------------------------------------1----------------------------------------------------------------------------------------------------------------------1---------------------------------2--1-----1-1----------1----------------------------3--1--111-----------1---21---------------1-2--2------------------------1-----1111-----11-1121111111111-------------------------------------3-1---------------------2---1-111111111---32111--------------------1-11--1--------------------------------------------------------------1-11112- -------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------5------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 272 STR:RPRED 100.0 SQ:SECSTR EEEcEEEcccTTTccccccEEEEEEEcTTcccccEEccccEEEEEEEcEEEEETTcccEEEETTcEEEEcTTcEEEEcccccEEEEEETGGGGGGccccccTTcEEccccTTTHHHHHHHHHHHHHHHTcccTTcTTccEEEEEEccHHHHHTTTTcGGGccTTccTTcHHHHHHHHHHHHTTTTcccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHHHc DISOP:02AL 156-170, 271-272| PSIPRED cccccccHHHcccccccEEEEEEEEcccEEcccccccccEEEEEEEEcEEEEEEccEEEEEcccEEEEEccccEEEEEEccccEEEEEEEEcHHHHHHHHHHcccccHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHccc //