[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0990
DDBJ      :CPE0990      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  53/68 : Bacteria  482/915 : Eukaryota  123/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:244 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->207 3a4iA PDBj 4e-23 13.3 %
:RPS:SCOP  14->229 1ni5A1  c.26.2.5 * 3e-26 20.8 %
:HMM:SCOP  1->217 1wy5A1 c.26.2.5 * 3.9e-50 35.5 %
:RPS:PFM   26->206 PF01171 * ATP_bind_3 3e-21 32.6 %
:HMM:PFM   26->205 PF01171 * ATP_bind_3 5.9e-21 27.2 173/182  
:BLT:SWISS 5->240 TTCA_GEOSL 4e-44 38.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80696.1 GT:GENE CPE0990 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1193131..1193865) GB:FROM 1193131 GB:TO 1193865 GB:DIRECTION - GB:GENE CPE0990 GB:PRODUCT conserved hypothetical protein GB:NOTE 244 aa, similar to gpu:AE004222_1 conserved hypothetical protein from Vibrio cholerae (310 aa); 37.8% identity in 230 aa overlap GB:PROTEIN_ID BAB80696.1 LENGTH 244 SQ:AASEQ MKTMQKLLSKTRQAIKEYNLIEDGDKIAVGLSGGKDSLTLLHILKNYQRFSPEKFELIAITLNPGGVDNSPLHELCKNIDVPFYEIQTDIKEIVFDIKKEKNPCSLCANLRRGALNDNAEKLGCNKVALGHHKDDALETLMLSISYEGRINCFSPKSFMHKNNLTLIRPMVFIEESQIRKAVAEYNFPVIKNPCPADGKTKREDMKNLIRSLDKTMPGFKKNLFKSLTNTDQMFVWDKEIVKKM GT:EXON 1|1-244:0| BL:SWS:NREP 1 BL:SWS:REP 5->240|TTCA_GEOSL|4e-44|38.1|236/282| RP:PDB:NREP 1 RP:PDB:REP 7->207|3a4iA|4e-23|13.3|196/286| RP:PFM:NREP 1 RP:PFM:REP 26->206|PF01171|3e-21|32.6|175/185|ATP_bind_3| HM:PFM:NREP 1 HM:PFM:REP 26->205|PF01171|5.9e-21|27.2|173/182|ATP_bind_3| RP:SCP:NREP 1 RP:SCP:REP 14->229|1ni5A1|3e-26|20.8|207/227|c.26.2.5| HM:SCP:REP 1->217|1wy5A1|3.9e-50|35.5|211/0|c.26.2.5|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 775 OP:NHOMOORG 658 OP:PATTERN 112-1211------11112-22111--1---1222222221231-1111111122222212-111211 --1--------------------------------------------------------------------------------111121111-21-----------1--1111111111111111---------------------1--1---------------------------------111--1-1-------------------------------1--111-1111------------------------------------------------------------------------------------------122-144444443431311222222212-32-2--111212113332-22-1-----111-1-------------11111111111---------11--111111111111--11-1-11111111--------------------------11-----------------------1111111111111111111111111111111111111111111111111111111111111111111111111111121112111-11111111111111111111111111111111111111111111111111111111211111111111111111--111-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1111111111111111111111111-1111111111111111111111111111111112221222221111111111111111111111111111111----------------1--------------------1-------11111-1-1--- 11-1223-1111-----111111111-11-1-1111-111-1111111111111111111111-1-111111-11111-1111121----11-1-111-1--1111111241---1------------------------------------------1--1131211-112221111-611-111112121211-112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 244 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHHHHHHHHHHHHHTTccEEEEEcccHHHHHHHHHHHHcHHHGGcTEGEEEEEEEccccHHHHHHHHTTTTccEEEEEHHHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHHHHTccEEEccccccccEEEcTTTTccHHHHHHHHHTTccHHHHTcccccTTGGGGGccccccHHHHHHHHHHHHHHHHHHHHTTcccHHHHHcHHHHHHHHHHHHHHHHHHccccEEcTTHHHH DISOP:02AL 244-245| PSIPRED cHHHHHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHHHccccEEEEEEEHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHcccccccccccccccccEEEEEEcccccHHHHHHHHHHccccEEEcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcc //