[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0999
DDBJ      :CPE0999      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
:51 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   5->42 PF00130 * C1_1 0.00026 26.9 26/53  
:BLT:SWISS 1->48 ZFP82_MOUSE 2e-04 34.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80705.1 GT:GENE CPE0999 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1204190..1204345 GB:FROM 1204190 GB:TO 1204345 GB:DIRECTION + GB:GENE CPE0999 GB:PRODUCT hypothetical protein GB:NOTE 51 aa, no significant homology. GB:PROTEIN_ID BAB80705.1 LENGTH 51 SQ:AASEQ MADRTLKCKDCGADFIFTEGEQAFYKEKGFENDPVRCLDCRRARKAQRNNR GT:EXON 1|1-51:0| BL:SWS:NREP 1 BL:SWS:REP 1->48|ZFP82_MOUSE|2e-04|34.0|47/100| HM:PFM:NREP 1 HM:PFM:REP 5->42|PF00130|0.00026|26.9|26/53|C1_1| OP:NHOMO 106 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- -11-------------------------------------------------------------------------------------------------------------------------------------1113322221---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1533333337373--11443--1-----413312-2---1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------2---------------------------------------------------------------------1-111---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 41-51| PSIPRED cccccEEccccccccEEcccHHHHHHHccccccccccHHHHHHHHHHHccc //