[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1028
DDBJ      :CPE1028      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:113 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->99 2dclC PDBj 2e-08 40.7 %
:RPS:PDB   3->106 2dclC PDBj 3e-13 34.0 %
:RPS:SCOP  9->66 1o51A  d.58.5.4 * 3e-11 33.9 %
:HMM:SCOP  5->107 1o51A_ d.58.5.4 * 6.5e-25 37.3 %
:RPS:PFM   7->101 PF02641 * DUF190 6e-11 31.6 %
:HMM:PFM   8->101 PF02641 * DUF190 1.7e-27 41.5 94/101  
:BLT:SWISS 10->99 Y666_PYRAB 2e-11 36.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80734.1 GT:GENE CPE1028 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1229962..1230303) GB:FROM 1229962 GB:TO 1230303 GB:DIRECTION - GB:GENE CPE1028 GB:PRODUCT conserved hypothetical protein GB:NOTE 113 aa, similar to pir:B75108 hypothetical protein PAB1926 from Pyrococcus abyssi (strain Orsay) (127 aa); 36.7% identity in 90 aa overlap GB:PROTEIN_ID BAB80734.1 LENGTH 113 SQ:AASEQ MRNEFKGSFLKIFIDESDKYNGEPLYLEILKVLKKENILGATVIRGIEGLDSHHKIHSDFIEILARNLPIVIEVIESKEKINELIELIEPMIETGTITVIDNIQVISLNKKTD GT:EXON 1|1-113:0| BL:SWS:NREP 1 BL:SWS:REP 10->99|Y666_PYRAB|2e-11|36.7|90/127| SEG 70->89|ivievieskekinelielie| BL:PDB:NREP 1 BL:PDB:REP 10->99|2dclC|2e-08|40.7|81/97| RP:PDB:NREP 1 RP:PDB:REP 3->106|2dclC|3e-13|34.0|94/97| RP:PFM:NREP 1 RP:PFM:REP 7->101|PF02641|6e-11|31.6|95/101|DUF190| HM:PFM:NREP 1 HM:PFM:REP 8->101|PF02641|1.7e-27|41.5|94/101|DUF190| RP:SCP:NREP 1 RP:SCP:REP 9->66|1o51A|3e-11|33.9|56/89|d.58.5.4| HM:SCP:REP 5->107|1o51A_|6.5e-25|37.3|102/0|d.58.5.4|1/1|GlnB-like| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN --------------------------------------------------11--111111-------- -------------------------------------------------------------------------------------1-1---------------------------------------------------1----------------------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1--------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 92.9 SQ:SECSTR ccccccEEEEEEEEETTcEETTEEHHHHHHHHHHHHTccccEEEEcccccccccEEEEEEEEEcTTccEEEEEEEEEHHHHHHHHHHHGGGccccEEEE#EEEccc####### DISOP:02AL 1-4, 111-113| PSIPRED ccccccEEEEEEEEcccccccccHHHHHHHHHHHHccccccHHHHHHHcccccccccccHHEEEcccccEEEEEEccHHHHHHHHHHHHHHHHcccEEEEccEEEEEEccccc //