[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1033
DDBJ      :CPE1033      probable choline kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.144.1
:266 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->251 2qg7D PDBj 3e-09 30.9 %
:RPS:PDB   14->252 3dxqB PDBj 1e-22 20.4 %
:RPS:SCOP  14->239 1nd4A  d.144.1.6 * 5e-10 11.7 %
:HMM:SCOP  14->251 1nw1A_ d.144.1.8 * 1.5e-27 23.4 %
:RPS:PFM   27->193 PF01633 * Choline_kinase 3e-06 29.5 %
:HMM:PFM   26->203 PF01633 * Choline_kinase 4.8e-19 26.1 176/211  
:BLT:SWISS 11->253 LICA2_HAEIN 8e-19 29.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80739.1 GT:GENE CPE1033 GT:PRODUCT probable choline kinase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1235303..1236103) GB:FROM 1235303 GB:TO 1236103 GB:DIRECTION - GB:GENE CPE1033 GB:PRODUCT probable choline kinase GB:NOTE 266 aa, similar to sp:LICA_HAEIN LICA PROTEIN from Haemophilus influenzae (strain RM7004) (339 aa); 28.7% identity in 258 aa overlap GB:PROTEIN_ID BAB80739.1 LENGTH 266 SQ:AASEQ MTNKMKNHKITKLGGLNNSNYLLECENNKYVLRIPSKDNKNNFSEENFVLIFANLNKLSPPIIYHNKDNGILISKFLEDSKVNMSTFTSLEFLEKLSINLKKLHILKCEHIFNPFEHIRKNFHILKSKNFNFHEGIDLVLNKLNILEEKLSKNMTLGLCHNDLNSSNVLYHNKNVLFIDFEFSAMCDIFFDLATVSWMLDEKKRYFLIKSYFGYYSYELMEKLENYLFVVKLWNASWSFLKSLNTNSTYDYKLGGNMIIDDLLSTL GT:EXON 1|1-266:0| BL:SWS:NREP 1 BL:SWS:REP 11->253|LICA2_HAEIN|8e-19|29.4|238/339| BL:PDB:NREP 1 BL:PDB:REP 29->251|2qg7D|3e-09|30.9|217/367| RP:PDB:NREP 1 RP:PDB:REP 14->252|3dxqB|1e-22|20.4|225/280| RP:PFM:NREP 1 RP:PFM:REP 27->193|PF01633|3e-06|29.5|166/202|Choline_kinase| HM:PFM:NREP 1 HM:PFM:REP 26->203|PF01633|4.8e-19|26.1|176/211|Choline_kinase| RP:SCP:NREP 1 RP:SCP:REP 14->239|1nd4A|5e-10|11.7|214/255|d.144.1.6| HM:SCP:REP 14->251|1nw1A_|1.5e-27|23.4|235/395|d.144.1.8|1/1|Protein kinase-like (PK-like)| OP:NHOMO 39 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------1-1-------2-1----1222-------1-----1-----------3---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------1------1111----1----1--1112-11-----------------------------------------------------------------------1--------------1--------1-----------1--2---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 94.7 SQ:SECSTR HHTccccccEEcccccccEEEEETccccTEEEEEccHHHHHHHHHHHHHTTcHHHTTccccEEEEcTTTccEEEEccTTcEEcHHHHHcTTHHHHHHHHHHHHHccccccccccHHHHHHHHHHHTTccccccTTHHHHHHHHHHHHHHHHTccccEEEcccccGGGEEEcccccEEcccTTccEEcHHHHHHHHHTTccHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccHH############## DISOP:02AL 1-2| PSIPRED cccccccEEEEEccccccEEEEEEEcccEEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEEccccEEEEEEEccccccHHHcccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccEEEEccEEEEEEEcccccccHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHc //