[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1078
DDBJ      :CPE1078      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:73 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80784.1 GT:GENE CPE1078 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1282959..1283180 GB:FROM 1282959 GB:TO 1283180 GB:DIRECTION + GB:GENE CPE1078 GB:PRODUCT hypothetical protein GB:NOTE 73 aa, no significant homology. GB:PROTEIN_ID BAB80784.1 LENGTH 73 SQ:AASEQ MSRKCCCSCNSCRRNSCGCRCGNNCCGFNNCGGFGNCGGFNNCGGFGNCGGFPLLWLLLLGCGGFGNCGGNWF GT:EXON 1|1-73:0| SEG 5->72|cccscnscrrnscgcrcgnnccgfnncggfgncggfnncggfgncggfpllwllllgcggfgncggnw| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccc //