[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1080
DDBJ      :CPE1080      pseudouridylate synthase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  868/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
d.265.1d.66.1
:236 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->229 3dh3C PDBj 2e-33 37.1 %
:RPS:PDB   3->236 3dh3B PDBj 2e-41 34.5 %
:RPS:SCOP  1->90 1dm9A  d.66.1.3 * 1e-07 16.9 %
:RPS:SCOP  64->236 1kskA4  d.265.1.3 * 1e-39 35.2 %
:HMM:SCOP  1->103 1fjgD_ d.66.1.2 * 4.4e-23 40.0 %
:HMM:SCOP  61->236 1vioA1 d.265.1.3 * 2.1e-45 35.1 %
:RPS:PFM   66->191 PF00849 * PseudoU_synth_2 2e-16 39.7 %
:HMM:PFM   65->196 PF00849 * PseudoU_synth_2 2e-25 27.3 132/164  
:HMM:PFM   3->46 PF01479 * S4 3e-13 40.9 44/48  
:BLT:SWISS 1->229 Y1464_AQUAE 2e-45 39.5 %
:PROS 101->115|PS01149|PSI_RSU
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80786.1 GT:GENE CPE1080 GT:PRODUCT pseudouridylate synthase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1284275..1284985 GB:FROM 1284275 GB:TO 1284985 GB:DIRECTION + GB:GENE CPE1080 GB:PRODUCT pseudouridylate synthase GB:NOTE 236 aa, similar to gpu:AP001512_163 pseudouridylate synthase from Bacillus halodurans (242 aa); 42.7% identity in 234 aa overlap GB:PROTEIN_ID BAB80786.1 LENGTH 236 SQ:AASEQ MEERLQKYMARCGVASRRKCEEIICSGKVKVNDTVVDSLGTKVDPSVDVVSVNNKVIRPEENKVYIMLNKPEGYVTTNKDEKNRKTILDIVKVNERIYPIGRLDYDSSGLLLLTNDGDVYNKIIHPRVNLNKEYIALVKGIFTEEEMNKFRKGVDIGDYKTAECEIELLEKYTNSCKVKIIIHEGKNRQIRRMCAAFNHEVVSLKREAIGSLTLKNLKKGEWRYLSSSEENYIKSL GT:EXON 1|1-236:0| BL:SWS:NREP 1 BL:SWS:REP 1->229|Y1464_AQUAE|2e-45|39.5|228/249| PROS 101->115|PS01149|PSI_RSU|PDOC00885| SEG 42->56|kvdpsvdvvsvnnkv| BL:PDB:NREP 1 BL:PDB:REP 4->229|3dh3C|2e-33|37.1|221/239| RP:PDB:NREP 1 RP:PDB:REP 3->236|3dh3B|2e-41|34.5|229/241| RP:PFM:NREP 1 RP:PFM:REP 66->191|PF00849|2e-16|39.7|126/149|PseudoU_synth_2| HM:PFM:NREP 2 HM:PFM:REP 65->196|PF00849|2e-25|27.3|132/164|PseudoU_synth_2| HM:PFM:REP 3->46|PF01479|3e-13|40.9|44/48|S4| GO:PFM:NREP 4 GO:PFM GO:0001522|"GO:pseudouridine synthesis"|PF00849|IPR006145| GO:PFM GO:0003723|"GO:RNA binding"|PF00849|IPR006145| GO:PFM GO:0009451|"GO:RNA modification"|PF00849|IPR006145| GO:PFM GO:0009982|"GO:pseudouridine synthase activity"|PF00849|IPR006145| RP:SCP:NREP 2 RP:SCP:REP 1->90|1dm9A|1e-07|16.9|89/104|d.66.1.3| RP:SCP:REP 64->236|1kskA4|1e-39|35.2|165/172|d.265.1.3| HM:SCP:REP 1->103|1fjgD_|4.4e-23|40.0|100/208|d.66.1.2|1/1|Alpha-L RNA-binding motif| HM:SCP:REP 61->236|1vioA1|2.1e-45|35.1|171/0|d.265.1.3|1/1|Pseudouridine synthase| OP:NHOMO 2034 OP:NHOMOORG 898 OP:PATTERN -------------------------------------------------------------------- 1221111111111111111-11111111111111111111111111111111111111--11111111111-1111111111121222111111-11--21333143412-1111111-11111111111111111111111111122222222222222222222222221211111211111112222-222-4444444344444422222244422232332222223332222222222222222222-21222212222211222222213333333333322333333333333333333333333333333333323324222222242422223344232222221111121111222222-22211333311111121111111111111111111111-3312212112112111222222221144122111112221111111111111322------------1111111111111-----1212-2222233333333333334333334333444343333333333332222553454444334333322243421113111111111111111121111113111211111111111111111112111233442355624545666567755556-77577--2111211111143333444444444444-4444444444444444444444333344444444444444443544434442-433343333444--2211111222224234333333333333222333333344333444433333144433331111111113544644444445445456666565222211122211111111111121311111-21111--11111--12---2212211111123 22--22--31--------------------------------------------------------------------------------------------------72-----------------------------------------------------3---------1-1-22A333-111-1-114432222 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 236 STR:RPRED 100.0 SQ:SECSTR HHEEHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEETTEEEccccGGGccEEEEEEcTTcccccccccTTcHHHHHTccccccEEccccccccEEEEEEEccTHHHHHHHcGGGcccEEEEEEEcccccHHHHHHHHTccccccccccccEEEEccccEETTEEEEEEccccTTHHHHHHHHTTccEEEEEEEEETTEEcTTccTTcEEEccHHHHHHHHHT PSIPRED cHHHHHHHHHHcccccHHHHHHHHHcccEEEccEEEcccccEEccccEEEEEEccccccccccEEEEEEccccEEEEccccccccHHHHHHccccEEEEEccccccccEEEEEEccHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHccccccccccccEEEEEEcccccEEEEEEEEccccHHHHHHHHHHcccEEEEEEEEEEEEEEccccccccEEEccHHHHHHHHcc //