[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1081
DDBJ      :CPE1081      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  180/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->185 3eeyI PDBj 4e-18 29.9 %
:RPS:PDB   32->185 3eeyI PDBj 4e-22 35.9 %
:RPS:SCOP  30->154 1ixkA  c.66.1.38 * 1e-06 22.9 %
:HMM:SCOP  6->186 1m6yA2 c.66.1.23 * 1.7e-14 17.8 %
:RPS:PFM   51->185 PF06962 * rRNA_methylase 4e-33 46.7 %
:HMM:PFM   51->185 PF06962 * rRNA_methylase 2.8e-53 55.6 135/140  
:BLT:SWISS 7->130 ARGB_STRMU 1e-05 29.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80787.1 GT:GENE CPE1081 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1284976..1285542 GB:FROM 1284976 GB:TO 1285542 GB:DIRECTION + GB:GENE CPE1081 GB:PRODUCT conserved hypothetical protein GB:NOTE 188 aa, similar to pir:G81942 hypothetical protein NMA0960 from Neisseria meningitidis (group A strain Z2491) (188 aa); 41.1% identity in 168 aa overlap. ATC start GB:PROTEIN_ID BAB80787.1 LENGTH 188 SQ:AASEQ MSIVIMFKYVSDVSNIYHNIITSFIENKNIAIDATLGNGHDCDFLSELFKKVYAFDIQEEAVNSYKSKNKENVEVILDSHENFETYIKEENVDCIVYNLGYLPGNNKEVTTVAHSTLKSIEIGLDLLGDNGLMIIALYSGHEEGKKEKDAVLQFTSKLPKNKYGVLHTEFTNRAKSAPSLVVIEKKFK GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 7->130|ARGB_STRMU|1e-05|29.3|116/245| BL:PDB:NREP 1 BL:PDB:REP 18->185|3eeyI|4e-18|29.9|167/186| RP:PDB:NREP 1 RP:PDB:REP 32->185|3eeyI|4e-22|35.9|153/186| RP:PFM:NREP 1 RP:PFM:REP 51->185|PF06962|4e-33|46.7|135/140|rRNA_methylase| HM:PFM:NREP 1 HM:PFM:REP 51->185|PF06962|2.8e-53|55.6|135/140|rRNA_methylase| RP:SCP:NREP 1 RP:SCP:REP 30->154|1ixkA|1e-06|22.9|118/305|c.66.1.38| HM:SCP:REP 6->186|1m6yA2|1.7e-14|17.8|180/193|c.66.1.23|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 192 OP:NHOMOORG 189 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1-1111111-1111111-------------------------------------------------------------------11111111111111111111111111111111111111111111111111111111111111-1--------11----1-1---11111111111111111111111-11111111111111111111111--11-1111111-1-11111111-1111---1-11111-111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-------------1-11---1111111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------1 ------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------4----11111-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 94.7 SQ:SECSTR ########ccccHHHHHHHHHHHHccTTcEEEEcccTTcHHHHHHHHHHcTTEEEcccHHHHHHHHHHHHHTEEEEcccGGGGGGTcccccEEEEEEEEcccTTccccccccHHHHHHHHHHHHHHEEEEEEEEEEEccccHHHHHHHHHHHHHHHTccTTTEEEEEEccTTccccccEEEEEEEc## DISOP:02AL 188-189| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccEEEEccccccccccEEEEccccHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHHHcccHHHEEEEEEEEccccccccEEEEEEEccc //