[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1135
DDBJ      :CPE1135      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:80 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80841.1 GT:GENE CPE1135 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1331702..1331944 GB:FROM 1331702 GB:TO 1331944 GB:DIRECTION + GB:GENE CPE1135 GB:PRODUCT hypothetical protein GB:NOTE 80 aa, no significant homology. GB:PROTEIN_ID BAB80841.1 LENGTH 80 SQ:AASEQ MNLRLMFERIIKRGYFPEGKENFGKKLDFMYGLNRLTDDDYAYLVGLLNPVPVVTPLPADHETSSVVVAPTETKVIESQA GT:EXON 1|1-80:0| SEG 44->58|lvgllnpvpvvtplp| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 79-80| PSIPRED ccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccHHHHHHHcccccEEccccccccccEEEEcccccccccccc //