[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1151
DDBJ      :CPE1151      probable malate oxidoreductase
Swiss-Prot:             

Homologs  Archaea  43/68 : Bacteria  714/915 : Eukaryota  145/199 : Viruses  0/175   --->[See Alignment]
c.2.1c.58.1
:381 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->375 2a9fB PDBj 1e-89 43.1 %
:RPS:PDB   3->377 2a9fA PDBj e-105 41.8 %
:RPS:SCOP  5->157 1vl6A2  c.58.1.3 * 4e-46 39.9 %
:RPS:SCOP  158->377 1vl6A1  c.2.1.7 * 1e-47 39.4 %
:HMM:SCOP  4->157 1vl6A2 c.58.1.3 * 7.2e-47 42.9 %
:HMM:SCOP  159->377 1llqA1 c.2.1.7 * 1.3e-61 46.3 %
:RPS:PFM   29->147 PF00390 * malic 2e-13 43.1 %
:RPS:PFM   161->377 PF03949 * Malic_M 9e-35 46.5 %
:HMM:PFM   159->378 PF03949 * Malic_M 2e-63 46.8 220/255  
:HMM:PFM   28->109 PF00390 * malic 3.2e-19 34.6 81/182  
:HMM:PFM   113->147 PF00390 * malic 1.7e-07 31.4 35/182  
:BLT:SWISS 3->364 MAO4_BACSU 2e-90 45.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80857.1 GT:GENE CPE1151 GT:PRODUCT probable malate oxidoreductase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1344643..1345788 GB:FROM 1344643 GB:TO 1345788 GB:DIRECTION + GB:GENE CPE1151 GB:PRODUCT probable malate oxidoreductase GB:NOTE 381 aa, similar to pir:T46727 probable malic enzyme from Weissella paramesenteroides plasmid (378 aa); 49.1% identity in 373 aa overlap. 1 putative transmembrane region was found by PSORT malic enzyme GB:PROTEIN_ID BAB80857.1 LENGTH 381 SQ:AASEQ MTKDELLKQRELAHGLISINPNFDINNREQLSQIYTPGVSTICKEVEHHHNMVKTLTSVGNSIAVITDGTAVLGLGNIGTLAGYPIVEAKALVYKDLAGVNAIPLCVDQIGCNELIKTIKSISPSFSGIHLEDIKAPECFYIEEELKKTLNIPVYHDDQHGTAIAVLGALYNGAKVVNKDFLKLKVLILGAGASGIATAKLLLKAGIEDIILVDKNGALVNGDETLNAPQKEMAKITNKEFKKGTLKEVIKGRDVFIGLSEGNLVTKEMVESMNEDPIIFALANPTPEIKPEIAKEAGARVIATGGPSYPNQINNILVFPGLFKGLLEAKATDVTCDVMIAVGKKLASLVENPTAEKIIPGVFDGDIVKSVSETVVKNIEN GT:EXON 1|1-381:0| BL:SWS:NREP 1 BL:SWS:REP 3->364|MAO4_BACSU|2e-90|45.0|362/410| BL:PDB:NREP 1 BL:PDB:REP 7->375|2a9fB|1e-89|43.1|367/380| RP:PDB:NREP 1 RP:PDB:REP 3->377|2a9fA|e-105|41.8|373/383| RP:PFM:NREP 2 RP:PFM:REP 29->147|PF00390|2e-13|43.1|116/180|malic| RP:PFM:REP 161->377|PF03949|9e-35|46.5|217/254|Malic_M| HM:PFM:NREP 3 HM:PFM:REP 159->378|PF03949|2e-63|46.8|220/255|Malic_M| HM:PFM:REP 28->109|PF00390|3.2e-19|34.6|81/182|malic| HM:PFM:REP 113->147|PF00390|1.7e-07|31.4|35/182|malic| GO:PFM:NREP 3 GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF00390|IPR012301| GO:PFM GO:0016616|"GO:oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor"|PF03949|IPR012302| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF03949|IPR012302| RP:SCP:NREP 2 RP:SCP:REP 5->157|1vl6A2|4e-46|39.9|153/154|c.58.1.3| RP:SCP:REP 158->377|1vl6A1|1e-47|39.4|218/222|c.2.1.7| HM:SCP:REP 4->157|1vl6A2|7.2e-47|42.9|154/154|c.58.1.3|1/1|Aminoacid dehydrogenase-like, N-terminal domain| HM:SCP:REP 159->377|1llqA1|1.3e-61|46.3|216/0|c.2.1.7|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 1346 OP:NHOMOORG 902 OP:PATTERN 11---12111111112-11111-111111112------------1--11-111-11111-11111--- 1-122--1111-1-11111-11--11111111111111531111-121----222--1--22312222222-------1--11--1--1111111111-11111111111------------------11--111-11111----112112211111------11111111-----------------11122333333222221232222331222222212--------11-1112112111111111111211-22-----2211321112122-11111---11------------11111111111111--------113-222222112111111111-212111211--12-11-111111111---11222122222113221111111112121121112-11411311221122212222222222112222222212211111111111-122111111111111111111111111111111111211333323233333222322222223223332222-1222212222222321121-1111111111111-22231---11211111113231122--1111-11111111111111-1--------111111332111422212222212222212222122--12112------222212-1111111111-1112111111111111111232112222222222222222222211111111-222222212222--11111112222-11211-111111111111122222122212111111111112121222-11111111-222322222222231111111111111111-111--11--------1--1111---------------------111--11111-11 --11111-1-1---111-1212111111111-111-11111111111122221112222222111111-111111111111-1-1----2221111212121-221---1--42634-2-112231-3-3E2-323-11-2--2121-112--413332---2-1--7221---1----A32312-48524---21-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 378 STR:RPRED 99.2 SQ:SECSTR cccccTTHHHHHHTcccccccccccccHHHHHHHcTTTTHHHHHHHHHcGGGHHHHcGGGTEEEEEEcccccTTcccccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHGGGccEEEEccccTTHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHHHHHTTTccTTccEEEEEcccHHHHHHHHHHHHHTccEEEEEETTEEcccTTTccccccccHHHHHccTTccccccHHHHTTccEEEcccTTcccHHHHHTcccccEEEEcccccccccHHHHHTTTccEEEEccTTccccccGGGTHHHHHHHHHHHTcccccHHHHHHHHHHHHHTcccccccccccccTTHHHHHHHTTTTccH### DISOP:02AL 381-382| PSIPRED ccHHHHHHHHHHcccEEEEEEccccccHHHccccccccHHHHHHHHHHHHHHHHcccHHccEEEEEcccccEEEEccccccccEEEEHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHcccEEEEEEHHcccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccHHccEEEEEcccHHHHHHHHHHHHHccccEEEEcccccEEccHHHccHHHHHHHHHcccccccccHHHHHccccEEEEccccccccHHHHHHcccccEEEEcccccccccHHHHHccccEEEEEcccccccccEEEEEEHHHHHHHHHcccEEccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHc //