[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1168
DDBJ      :CPE1168      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.81.1
:110 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  48->95 1dapA2  d.81.1.3 * 7e-04 29.8 %
:BLT:SWISS 10->93 SYE2_SYNWW 3e-04 36.4 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80874.1 GT:GENE CPE1168 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1367695..1368027) GB:FROM 1367695 GB:TO 1368027 GB:DIRECTION - GB:GENE CPE1168 GB:PRODUCT hypothetical protein GB:NOTE 110 aa, no significant homology. GB:PROTEIN_ID BAB80874.1 LENGTH 110 SQ:AASEQ MKDTKTKEHIARIAKASTYFIFRNGPVNKLHKENKVSDEELKEMQEYMQNHLAYLYEVLLEEGNLKKYELVMNTMNQFYVNDDTEVVLADEDFDSLYDQLFPKSSNIILK GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 10->93|SYE2_SYNWW|3e-04|36.4|77/100| RP:SCP:NREP 1 RP:SCP:REP 48->95|1dapA2|7e-04|29.8|47/150|d.81.1.3| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 32-41| PSIPRED ccccHHHHHHHHHHHHHEEEEEEccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHEEEccccEEEEEcccHHHHHHHHccccccEEEc //