[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1171
DDBJ      :CPE1171      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.113.1
:127 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->120 3cngB PDBj 3e-09 15.3 %
:RPS:SCOP  1->125 1mutA  d.113.1.1 * 2e-12 20.8 %
:HMM:SCOP  1->126 1punA_ d.113.1.1 * 7.7e-10 19.8 %
:HMM:PFM   8->110 PF00293 * NUDIX 1.3e-05 21.4 103/135  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80877.1 GT:GENE CPE1171 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1369260..1369643) GB:FROM 1369260 GB:TO 1369643 GB:DIRECTION - GB:GENE CPE1171 GB:PRODUCT hypothetical protein GB:NOTE 127 aa, no significant homology. GB:PROTEIN_ID BAB80877.1 LENGTH 127 SQ:AASEQ MSNIKFCSIIIKDDFNNILISKRKGKKADEHLWYIFERKIKGRETPEKCANRAIKEDLKTIVFDLNQLCDLNVNEEETLRVFTGSLKEKITCGSNITTYKWISKDDLNDYTFANGELEKINAFFDTI GT:EXON 1|1-127:0| RP:PDB:NREP 1 RP:PDB:REP 1->120|3cngB|3e-09|15.3|118/172| HM:PFM:NREP 1 HM:PFM:REP 8->110|PF00293|1.3e-05|21.4|103/135|NUDIX| RP:SCP:NREP 1 RP:SCP:REP 1->125|1mutA|2e-12|20.8|125/129|d.113.1.1| HM:SCP:REP 1->126|1punA_|7.7e-10|19.8|126/0|d.113.1.1|1/1|Nudix| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 125 STR:RPRED 98.4 SQ:SECSTR ccccEEEEEEEEEETTEEEEEEEcTTccccTTcEEccEEEcTTccHHHHHHHHHHHHHcccEEEEEEEEEEEEGGGTEEEEEEEEccccccccTTEEEEEEEcTTTccGGGcccHHHHHHHHHHH## DISOP:02AL 1-3| PSIPRED ccccEEEEEEEEcccccEEEEcccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHEEcccccEEEEEccccccccEEEccccHHHHHHHHHcc //