[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1190
DDBJ      :CPE1190      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  155/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:515 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   70->421 PF00324 * AA_permease 2e-13 24.6 %
:HMM:PFM   32->497 PF00324 * AA_permease 9e-17 19.4 433/479  
:BLT:SWISS 8->491 YJEM_ECOLI e-136 48.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80896.1 GT:GENE CPE1190 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1386523..1388070) GB:FROM 1386523 GB:TO 1388070 GB:DIRECTION - GB:GENE CPE1190 GB:PRODUCT conserved hypothetical protein GB:NOTE 515 aa, similar to pir:S56384 hypothetical 56.3K protein (genX-psd intergenic region) from Escherichia coli (514 aa); 52.1% identity in 484 aa overlap. Putative N-terminal signal sequence and 8 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80896.1 LENGTH 515 SQ:AASEQ MSSEHKSKLSLTALILMIFTSVYGFANMPKAFYLMGYSAIPWYIISALAFSIPYAFMMAEYGAAFRKERGGIYSWMAKSVGPKYAFIVTFMWYSSNLIWLVSNSSSIWIPFSNVIYGKDTTGTWSLLGLSVPQTMAVLGSILIIVITYASSKGLKSITKVTSIGGTVVALSNIVLILGAIIVFVSNGFKPAEVINGAAFVHAQNPSYQSPIGVLGFLVFAVFAYGGLEAVSGLVDETKDAKKNFPKGLMIASIIIAVGYAVGILCVGLFTNWQEVLSGDNVNLANVAYIVIQNLGVKLGQAFGMSTNASLQLGAWFARYIGLSMMLALMGAFFTLSYAPIKQLIEGTPKEIWPKKWTVLNENNMPVNAMWVQCIVVVIFILVASFGGESANKFFSYLILMGNVAMTIPYMFLSGAFPAFKKKKHIEKPFVMYKSYKSSLIWSIIVTFTIGFANLFTIIKPVIQDKDYTAMAFQITGPIVFSIIAFILYHNYEKKMKNRKNREESLFLKKLLIFII GT:EXON 1|1-515:0| BL:SWS:NREP 1 BL:SWS:REP 8->491|YJEM_ECOLI|e-136|48.2|481/500| TM:NTM 12 TM:REGION 10->32| TM:REGION 35->57| TM:REGION 80->102| TM:REGION 125->147| TM:REGION 164->186| TM:REGION 211->233| TM:REGION 251->273| TM:REGION 318->340| TM:REGION 367->389| TM:REGION 394->416| TM:REGION 439->461| TM:REGION 468->490| SEG 492->503|ekkmknrknree| SEG 505->514|lflkkllifi| RP:PFM:NREP 1 RP:PFM:REP 70->421|PF00324|2e-13|24.6|313/429|AA_permease| HM:PFM:NREP 1 HM:PFM:REP 32->497|PF00324|9e-17|19.4|433/479|AA_permease| GO:PFM:NREP 3 GO:PFM GO:0006810|"GO:transport"|PF00324|IPR004841| GO:PFM GO:0016020|"GO:membrane"|PF00324|IPR004841| GO:PFM GO:0055085|"GO:transmembrane transport"|PF00324|IPR004841| OP:NHOMO 346 OP:NHOMOORG 161 OP:PATTERN ------1------------------------------------1-1---------------------- --------------------------------------11----------------------------------------1-------1111-1-----------------------------------------------------------------------------------------------------------------------------------11121-----------------------343143124-7222243443--1323-------2--------------------------1-------------24444444343-1112666----1----------------11-------1---------------------11-1111--------------11-------------------------------------------------------------------------------1------------------------------------------------------------------------------2-1---1--------------------------------------------2-----------------1------------------------1---2--3332322233-3333322333323233332111-----222222222222222211-11111--1--------------------3333--------------------------1----------------------232213313--222-----22-22-------------------------------------------1--------1-------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-10, 490-505| PSIPRED cccccccEEHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHccccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHEEEEEEEcHHHccccccEEEHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHc //