[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1209
DDBJ      :CPE1209      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:111 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   50->92 PF07701 * HNOBA 0.00032 20.9 43/220  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80915.1 GT:GENE CPE1209 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1414899..1415234) GB:FROM 1414899 GB:TO 1415234 GB:DIRECTION - GB:GENE CPE1209 GB:PRODUCT hypothetical protein GB:NOTE 111 aa, no significant homology. GB:PROTEIN_ID BAB80915.1 LENGTH 111 SQ:AASEQ MSKYKVGDELIIVTDPNQETKKLKDLSFLKKDGDFACLSWGIKIVDVLYEKPNVTLTYKNVMGETNKVFAVCKNVENFDHEKVLEKALLKAFQNELTNITVIKNSGLKTIL GT:EXON 1|1-111:0| SEG 21->34|kklkdlsflkkdgd| HM:PFM:NREP 1 HM:PFM:REP 50->92|PF07701|0.00032|20.9|43/220|HNOBA| OP:NHOMO 8 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-2----1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEHHHHHHHHHHHccccEEEEEHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHccEEEEEEcccccccc //