[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1213
DDBJ      :CPE1213      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:68 amino acids
:PSIPRED
:RPS:SCOP  22->68 2av9A1  d.38.1.1 * 5e-04 15.9 %
:HMM:SCOP  4->66 2hx5A1 d.38.1.1 * 0.00025 19.7 %
:HMM:PFM   6->63 PF00703 * Glyco_hydro_2 0.00015 17.2 58/110  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80919.1 GT:GENE CPE1213 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1419531..1419737) GB:FROM 1419531 GB:TO 1419737 GB:DIRECTION - GB:GENE CPE1213 GB:PRODUCT hypothetical protein GB:NOTE 68 aa, no significant homology. GB:PROTEIN_ID BAB80919.1 LENGTH 68 SQ:AASEQ MEITYIIETEYDEITPIKVSLKYTVKRENHNKLVATGKTLQTFVDSKTFKIINIKKVHPEIWSKLTKY GT:EXON 1|1-68:0| SEG 2->15|eityiieteydeit| HM:PFM:NREP 1 HM:PFM:REP 6->63|PF00703|0.00015|17.2|58/110|Glyco_hydro_2| RP:SCP:NREP 1 RP:SCP:REP 22->68|2av9A1|5e-04|15.9|44/142|d.38.1.1| HM:SCP:REP 4->66|2hx5A1|0.00025|19.7|61/0|d.38.1.1|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEEEEEEcccccEEEEEEEEEEEEcccEEEEccEEEEEEEcccccEEEEEEEccHHHHHHHHcc //