[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1214
DDBJ      :CPE1214      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  165/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->71 1z54D PDBj 3e-17 47.9 %
:RPS:PDB   6->73 2egiA PDBj 3e-10 38.2 %
:RPS:SCOP  1->73 2gf6A1  d.38.1.1 * 3e-19 24.7 %
:HMM:SCOP  1->73 2hx5A1 d.38.1.1 * 9.2e-21 39.7 %
:HMM:PFM   18->73 PF03061 * 4HBT 1.7e-11 24.5 49/79  
:BLT:SWISS 3->71 YNEP_BACSU 7e-14 42.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80920.1 GT:GENE CPE1214 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1419709..1419942) GB:FROM 1419709 GB:TO 1419942 GB:DIRECTION - GB:GENE CPE1214 GB:PRODUCT conserved hypothetical protein GB:NOTE 77 aa, partially similar to pir:B75463 conserved hypothetical protein from Deinococcus radiodurans (strain R1) (142 aa); 47.8% identity in 69 aa overlap GB:PROTEIN_ID BAB80920.1 LENGTH 77 SQ:AASEQ MKSISKIKVRYAETDAMQVVHHANYYIYFEVAREDFIEQFGITYKEMEDQGIMMPLVETQCKYIDAARYGDNLHNRN GT:EXON 1|1-77:0| BL:SWS:NREP 1 BL:SWS:REP 3->71|YNEP_BACSU|7e-14|42.0|69/138| BL:PDB:NREP 1 BL:PDB:REP 1->71|1z54D|3e-17|47.9|71/130| RP:PDB:NREP 1 RP:PDB:REP 6->73|2egiA|3e-10|38.2|68/123| HM:PFM:NREP 1 HM:PFM:REP 18->73|PF03061|1.7e-11|24.5|49/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 1->73|2gf6A1|3e-19|24.7|73/134|d.38.1.1| HM:SCP:REP 1->73|2hx5A1|9.2e-21|39.7|73/0|d.38.1.1|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 173 OP:NHOMOORG 165 OP:PATTERN -------------------------------------------------------------------- 111-----------------------------------------------------------------------------1--1-------1-------12222111-1-------------------------1------------------------------------------------11111----1111111111111111111111-1111111111-11-111111111111111111111111----------------------------------11----------------------------------11-111111111-1-2-11-11-1-1--111--11-1---1--1111---1-2-----------------------------------------------------------------------1----------------------------------------------------------------------11--------1------111-------------------------------------11111-11111111---11-11111111--1-------------------------------1---1-------------------------------1----1--111-------1---------1-1---------1--------------------1---------1--------------1----------------------------------------1-----------------1----------11----------------------------1----------------------------------------------------12- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 96.1 SQ:SECSTR ccEEEEEEccGGGccTTccccTHHHHHHHHHHHHHHHHHTTccHHHHHTTTcEEEEEEEEEEEcccccTTcEEE### DISOP:02AL 77-78| PSIPRED cEEEEEEEEEHHHccccccEEHHHHHHHHHHHHHHHHHHccccHHHHHHcccEEEEEEEEEEEEcccccccEEEEEc //