[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1243
DDBJ      :CPE1243      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.17
:68 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   1->64 3cjkB PDBj 2e-07 12.5 %
:RPS:SCOP  2->64 1fvqA  d.58.17.1 * 4e-08 23.8 %
:HMM:SCOP  1->67 1k0vA_ d.58.17.1 * 1.4e-09 28.4 %
:HMM:PFM   8->64 PF00403 * HMA 5e-07 24.6 57/62  
:BLT:SWISS 8->66 COPZ_STAAW 2e-05 28.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80949.1 GT:GENE CPE1243 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1450428..1450634) GB:FROM 1450428 GB:TO 1450634 GB:DIRECTION - GB:GENE CPE1243 GB:PRODUCT hypothetical protein GB:NOTE 68 aa, no significant homology. GB:PROTEIN_ID BAB80949.1 LENGTH 68 SQ:AASEQ MEKIHCLVDGLGSSTNKTQVKNALENLDGVQKVCVDVARGSIEVMFNEHTSEGEIKNCIENTGFSIRS GT:EXON 1|1-68:0| BL:SWS:NREP 1 BL:SWS:REP 8->66|COPZ_STAAW|2e-05|28.8|59/68| RP:PDB:NREP 1 RP:PDB:REP 1->64|3cjkB|2e-07|12.5|64/75| HM:PFM:NREP 1 HM:PFM:REP 8->64|PF00403|5e-07|24.6|57/62|HMA| RP:SCP:NREP 1 RP:SCP:REP 2->64|1fvqA|4e-08|23.8|63/72|d.58.17.1| HM:SCP:REP 1->67|1k0vA_|1.4e-09|28.4|67/0|d.58.17.1|1/1|HMA, heavy metal-associated domain| OP:NHOMO 14 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111-----11-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 66 STR:RPRED 97.1 SQ:SECSTR cEEEEEEEcccccHHHHHHHHHHHHTcTTEEEEEEETTTTEEEEEEcTTccHHHHHHHHHHTTcEE## DISOP:02AL 1-2, 67-68| PSIPRED cccHHHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHccccccc //