[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1247
DDBJ      :CPE1247      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  240/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.69.1d.108.1
:851 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  90->175 1cvlA  c.69.1.18 * 6e-04 25.6 %
:HMM:SCOP  635->828 1lrzA3 d.108.1.4 * 1.2e-11 21.1 %
:RPS:PFM   199->292 PF03706 * UPF0104 8e-18 40.4 %
:RPS:PFM   523->813 PF09924 * DUF2156 9e-63 41.7 %
:HMM:PFM   522->814 PF09924 * DUF2156 2.3e-97 38.6 293/298  
:HMM:PFM   61->293 PF03706 * UPF0104 4.8e-14 18.7 225/294  
:BLT:SWISS 3->820 MPRF_STAAW e-103 29.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80953.1 GT:GENE CPE1247 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1452739..1455294) GB:FROM 1452739 GB:TO 1455294 GB:DIRECTION - GB:GENE CPE1247 GB:PRODUCT conserved hypothetical protein GB:NOTE 851 aa, similar to gp:D85082_8 YfiX from Bacillus subtilis (610 aa); 36.1% identity in 581 aa overlap. Putative N-terminal signal sequence and 13 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80953.1 LENGTH 851 SQ:AASEQ MKLNIKISDKLKLFFKIAFVSVVILFIVREFTSVFKNFNSEYFFMYRNKLDFLNLLIIAALGIISYIPLSFYDFILKRKVGIRLKNRKLYKYSWIASSIASLLGFGGATSLAFKQYFYGDYVDDKKKLLKEIGKIVALNLTGLSIVCCTYMGIRISSWNNLGIIKYAIGIIALYAPGFIIYSAYKYSKTKDKLEFFSTLGIIFISFLEWLTTIILIYATLRITGASISVLTFLPIYIEAAVVGMISMIPGGIGTFDLTFMTGLEVLGIPIEQTLLVIILYRISYYIVPALIGVLLFVHDFGGKINKKFNGLPYEIVSKVAYKIVVSLVFISGAIIVLSNIAPQYLLKIKLLKEILGKQVLGLSIGMSVVLGFLIMLAALMLKYRAKSIYKASMVLFILGIILSLTKGINPYELVFLIIVAYLLYLSKRMFYRDSFVVSCKNTLIDSGILIASFSIYFFILITFGTHLKYVGIVRKMPYKMAYKFGFIAFALVTVIYVAIYFLNIRRKIPVKTFDQCSEYVEKIIEEYKGDSLTHLVFLKDKYIYLNEDKDLFIQYEVYGDKLFVLGNPVGNNENLFREIEKFCEYADNYGYTPVFYQVNDEMISYLHSNGYDFMKIGEEAKVDVKEFKVVGNKMKSLKTSRSKVTKEGYTFHMVEPPFSKEFLDSLREISDEWLDGRKEKGFSVGFFDEDYLNKAPIAILKDREGEIKAFANIMYMYDNESFSVDLMRFSKNTPRGVMDFMFINLIEYGKENGYEIFNMGMAPLANVGLSKYAFWNEKLALQFYENGQALYSFKGLRRFKEKFSHNWEYKYIAYRRNTSILITVIQAAIVCSRNRNVDESIVVRNLKSLIK GT:EXON 1|1-851:0| BL:SWS:NREP 1 BL:SWS:REP 3->820|MPRF_STAAW|e-103|29.4|803/840| TM:NTM 13 TM:REGION 12->34| TM:REGION 52->74| TM:REGION 131->153| TM:REGION 163->184| TM:REGION 194->216| TM:REGION 234->256| TM:REGION 277->299| TM:REGION 319->341| TM:REGION 359->381| TM:REGION 387->409| TM:REGION 413->435| TM:REGION 441->463| TM:REGION 482->504| SEG 53->64|lnlliiaalgii| SEG 345->357|llkikllkeilgk| RP:PFM:NREP 2 RP:PFM:REP 199->292|PF03706|8e-18|40.4|94/291|UPF0104| RP:PFM:REP 523->813|PF09924|9e-63|41.7|290/294|DUF2156| HM:PFM:NREP 2 HM:PFM:REP 522->814|PF09924|2.3e-97|38.6|293/298|DUF2156| HM:PFM:REP 61->293|PF03706|4.8e-14|18.7|225/294|UPF0104| RP:SCP:NREP 1 RP:SCP:REP 90->175|1cvlA|6e-04|25.6|86/316|c.69.1.18| HM:SCP:REP 635->828|1lrzA3|1.2e-11|21.1|166/0|d.108.1.4|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 274 OP:NHOMOORG 245 OP:PATTERN --------------------------------------------------111--------------- ----31--111---11111-1-111-111111----12221---4----2112-21-------12--321-1111111-----------------------1---1---1-----------------------------------1----22---11----------1-1-----------------------1111111111111111--1111111---1-11111111-1111111111111111111111-1-12-1---11111211-11-111111----------------------------------111-----------------------1333---11----------------------1--1111------------------11111111111-------1--1--111211111111--------1-11-----------------11-------------------------------13-------1111111----1111------111------111-1---------------------------------1-------1-------------1111-1-----------------------------1---1-------1111---111-----------------------------------------------------------------------------------------------------------------------1-----------------------1---1-11111111-1111-111------------------------11111111111111----------------------------------------------------------- --------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 509-516| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccEEEHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccHHHHHHHcccEEEEcccccEEEEEEEEccEEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEEcHHHHHHHHHccccEEEEccEEEEccccccccccccHHHHHHHHHHHHccEEEEEEcccccHHHHHHHHHHHHHHHccccccEEEEEcccccccccccEEEEEcccccEEEEEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcc //