[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1248
DDBJ      :CPE1248      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  79/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:312 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   26->162 1dquA PDBj 6e-04 16.5 %
:RPS:PFM   134->289 PF03706 * UPF0104 3e-14 35.5 %
:HMM:PFM   134->288 PF03706 * UPF0104 6.2e-17 25.3 150/294  
:HMM:PFM   51->175 PF06454 * DUF1084 3.1e-05 18.9 122/281  
:HMM:PFM   9->62 PF11190 * DUF2976 0.00012 29.6 54/87  
:BLT:SWISS 1->308 MPRF_STAAU 5e-31 28.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80954.1 GT:GENE CPE1248 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1455868..1456806) GB:FROM 1455868 GB:TO 1456806 GB:DIRECTION - GB:GENE CPE1248 GB:PRODUCT conserved hypothetical protein GB:NOTE 312 aa, similar to pir:A69805 hypothetical protein yfiW from Bacillus subtilis (258 aa); 31.8% identity in 195 aa overlap. Putative N-terminal signal sequence and 5 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80954.1 LENGTH 312 SQ:AASEQ MKIKVNNKVKLFLKITFIAVVLVLVAFGFKNMFKEFNMTYFNMYRDKLHFFKLTLIAIAGIIAYMPLSIYDFILKKNVGIDIKNIKLYKYSWIASSIASLLGFGGATSLAFKQYFYGSHVKDKKKLLREIGKIIFLNLTGLSVLCIIYILLEFKDIQNLGLIKYVVYGVSAYAPLVIINSLYNYKKKKDEEGFTLKVVGISFVEWTLNMLLIYLILAITGAHIKLTEYFYVYVRATAVGIVSMVPGGLGTFDLTFIDGFKALGVPIEQTFLVIILYRISYFILPAAIGGILYIHEFGMNFKALIKSRKNNED GT:EXON 1|1-312:0| BL:SWS:NREP 1 BL:SWS:REP 1->308|MPRF_STAAU|5e-31|28.3|307/840| TM:NTM 8 TM:REGION 10->32| TM:REGION 50->72| TM:REGION 88->110| TM:REGION 129->151| TM:REGION 159->181| TM:REGION 197->219| TM:REGION 227->249| TM:REGION 259->281| RP:PDB:NREP 1 RP:PDB:REP 26->162|1dquA|6e-04|16.5|133/513| RP:PFM:NREP 1 RP:PFM:REP 134->289|PF03706|3e-14|35.5|152/291|UPF0104| HM:PFM:NREP 3 HM:PFM:REP 134->288|PF03706|6.2e-17|25.3|150/294|UPF0104| HM:PFM:REP 51->175|PF06454|3.1e-05|18.9|122/281|DUF1084| HM:PFM:REP 9->62|PF11190|0.00012|29.6|54/87|DUF2976| OP:NHOMO 83 OP:NHOMOORG 79 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------1---1-----------------1------------------------111111111111111--1111111---1-1-111111-1111111111111111111111-1-12-1---11111111-------111----------------------------------111-----------------------1222-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 133 STR:RPRED 42.6 SQ:SECSTR #########################HHHcccccccTTccccTTccEEEcccHHHHHHHH##HHHTTcc##cEEEcccccccHHHHHHHHHHHHHHcTTcEEEEEccccccGGGTccHHHHHcHHHHHHHHTEEEEETTHHHHHHHHHHHHHHHTHHHHHHHT###################################################################################################################################################### DISOP:02AL 1-5, 303-312| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //