[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1252
DDBJ      :CPE1252      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  89/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:240 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80958.1 GT:GENE CPE1252 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1460384..1461106) GB:FROM 1460384 GB:TO 1461106 GB:DIRECTION - GB:GENE CPE1252 GB:PRODUCT conserved hypothetical protein GB:NOTE 240 aa, similar to gpu:AE004082_1 conserved hypothetical protei from Xylella fastidiosa (253 aa); 39.7% identity in 234 aa overlap. 7 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB80958.1 LENGTH 240 SQ:AASEQ MRRESNPALAAGFEKAVSDGTTMTVGGTIVKILIMTAILGVAFVYSWIAFQNPDVNYKSALVVSLGGSLILGLLTSFIPKIAQFTAVFYAAFEGVLLGSISRYFESMFPGIVFPAMLLTIICLVATVLIYRRTPDIAGRISRGVFIAIISIGAIYLLGMVLSFFGITLPIYGSGIIGIGFSLFVVAIATASLIMDYDFILKASQYGYPKYMEWYGAFGLMVTLIWLYTEILNLLAKFSDN GT:EXON 1|1-240:0| TM:NTM 7 TM:REGION 25->47| TM:REGION 58->80| TM:REGION 82->104| TM:REGION 108->130| TM:REGION 143->165| TM:REGION 175->197| TM:REGION 215->237| SEG 61->74|lvvslggslilgll| SEG 170->179|iygsgiigig| OP:NHOMO 98 OP:NHOMOORG 95 OP:PATTERN --------------------------------------11111------------------------- 1----111---1-11------1---1------1111-----11-1-1111-112111---11111111---------------------------------1---11-----------------1-----------------------------------------------------------------1---111111111111121------111-----11------------------------------------------------------------------------------------------------------------11-1------111---------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111-11--------------------------------------------11111111111111---1------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 8-11, 14-17, 239-240| PSIPRED ccccccHHHHHcHHHEEccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccEEccEEEccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //