[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1280
DDBJ      :CPE1280      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->45 PF02031 * Peptidase_M7 0.0007 24.2 33/132  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB80986.1 GT:GENE CPE1280 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1504584..1504736) GB:FROM 1504584 GB:TO 1504736 GB:DIRECTION - GB:GENE CPE1280 GB:PRODUCT hypothetical protein GB:NOTE 50 aa, no significant homology. GB:PROTEIN_ID BAB80986.1 LENGTH 50 SQ:AASEQ MGNKNRNSKKKMASLGLRKDENGDYKYIDPNDTTSEFVPVRNHGRKSSNN GT:EXON 1|1-50:0| HM:PFM:NREP 1 HM:PFM:REP 13->45|PF02031|0.0007|24.2|33/132|Peptidase_M7| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-18, 40-50| PSIPRED ccccccccHHHHHHccccccccccEEEEccccccccEEEccccccccccc //