[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1307
DDBJ      :CPE1307      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.79.4
:255 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   8->211 3c9tB PDBj 1e-08 17.6 %
:RPS:SCOP  8->130 2z1eA1  d.79.4.1 * 9e-08 14.2 %
:HMM:PFM   47->96 PF00586 * AIRS 0.00081 26.0 50/96  
:BLT:SWISS 37->241 BIOB_CALS8 4e-05 27.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81013.1 GT:GENE CPE1307 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1547694..1548461) GB:FROM 1547694 GB:TO 1548461 GB:DIRECTION - GB:GENE CPE1307 GB:PRODUCT hypothetical protein GB:NOTE 255 aa, similar to gpu:AP001510_28 BH0853 gene product from Bacillus halodurans (227 aa); 36.8% identity in 209 aa overlap. 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB81013.1 LENGTH 255 SQ:AASEQ MQIYKFRDLTVLENEKNKLVIACDSCGGIGENEGDFVKASNEIVSYFSARVCLFELLAFRAKPLVIVNNLGMSMNNGGEKIIQGINRAIKEYNAENFFEEKSNLSECVTGSTEDNFKTLQTFLGLTIIGEKEETLKVNFEKGDSICLLGIPKVGQEVLEDINNNLGEIVTFKDFKILMDNKDVKDILPIGSKGIIHEISELENSDKIRINLSYEGDYLRKSAGPATALLFILRNNSLEDIKNKIKTPIMEIGNII GT:EXON 1|1-255:0| BL:SWS:NREP 1 BL:SWS:REP 37->241|BIOB_CALS8|4e-05|27.8|187/330| RP:PDB:NREP 1 RP:PDB:REP 8->211|3c9tB|1e-08|17.6|187/309| HM:PFM:NREP 1 HM:PFM:REP 47->96|PF00586|0.00081|26.0|50/96|AIRS| RP:SCP:NREP 1 RP:SCP:REP 8->130|2z1eA1|9e-08|14.2|106/113|d.79.4.1| OP:NHOMO 38 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------1-----------------1-------1111---111111---------------------------------------------------------------------------------------------11--1111111-1------111-1---1--1-11-----111211------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 241 STR:RPRED 94.5 SQ:SECSTR #######ccEEEEETTEEEEEEEEEccEEEcTTTccTTccHHHHHHHHHHHHHHHHHHTTcEEEEEEEEEEEcTTHHHHHHHHHHHHHHHHHTcEHTc#######EEEEEEEEEcccccccEEEEEEEEEEcccccccccTTcEEEEcccccHHccccHHHHHHHHHHcccccGGGHHHHHHHccEEEEEcccHHHHHHHHHHHHTcEEEETccHHHHTTTccTTEEEEEEEcTTTHHHHHHHHHccccEEEEEE DISOP:02AL 255-256| PSIPRED cccEEEEEEEEEEccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHHHHHHHccccccHHHHcccccEEEccccccEEEEEEEEEEEEEEEcccccccccccccEEEEEcccccHHHHHccccccccccccHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHcccEEEccccccccccccccEEEEEEEEEHHHHHHHHHHHcccHHHHEEEc //