[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1308
DDBJ      :CPE1308      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:169 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->161 PF07155 * DUF1393 1.3e-09 23.8 151/169  
:BLT:SWISS 61->166 OPSD_GALML 3e-04 34.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81014.1 GT:GENE CPE1308 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1548448..1548957) GB:FROM 1548448 GB:TO 1548957 GB:DIRECTION - GB:GENE CPE1308 GB:PRODUCT hypothetical protein GB:NOTE 169 aa, no significant homology. Putative N-terminal signal sequence and 3 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81014.1 LENGTH 169 SQ:AASEQ MNFTKEKKRLDVKSLCFSAILIAISVILANFPIFSSIALDSMPAFVGGIIISPVVGGIIGLLAHLFVALRTGFPLSLPVHILVALEMFVVVYITSIIFNRGKVILAGIVGTLLNGIVFTLITGVFMYFVLGGMNPIDFLKLLGLPLTLASLVNIVVAFIVSKGLKNANI GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 61->166|OPSD_GALML|3e-04|34.3|99/100| TM:NTM 5 TM:REGION 14->36| TM:REGION 47->69| TM:REGION 75->97| TM:REGION 107->129| TM:REGION 140->162| SEG 18->29|sailiaisvila| SEG 46->60|vggiiispvvggiig| HM:PFM:NREP 1 HM:PFM:REP 11->161|PF07155|1.3e-09|23.8|151/169|DUF1393| OP:NHOMO 18 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------1--111111---------111----------11-----1--211------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 167-169| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //