[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1312
DDBJ      :CPE1312      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  17/68 : Bacteria  471/915 : Eukaryota  30/199 : Viruses  0/175   --->[See Alignment]
c.108.1
:277 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->269 1nf2A PDBj 2e-26 31.9 %
:RPS:PDB   4->270 3dnpA PDBj 8e-32 22.7 %
:RPS:SCOP  4->274 1kytA  c.108.1.10 * 3e-54 24.4 %
:HMM:SCOP  1->276 2b30A1 c.108.1.10 * 2.8e-69 39.2 %
:RPS:PFM   6->269 PF08282 * Hydrolase_3 1e-37 39.4 %
:HMM:PFM   6->269 PF08282 * Hydrolase_3 9e-75 40.5 252/254  
:BLT:SWISS 4->269 YWTE_BACSU 1e-32 35.7 %
:PROS 223->245|PS01229|COF_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81018.1 GT:GENE CPE1312 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1552125..1552958) GB:FROM 1552125 GB:TO 1552958 GB:DIRECTION - GB:GENE CPE1312 GB:PRODUCT conserved hypothetical protein GB:NOTE 277 aa, similar to sp:YXEH_BACSU HYPOTHETICAL 30.2 KDA PROTEIN IN IDH-DEOR INTERGENIC REGION from Bacillus subtilis (270 aa); 35.3% identity in 272 aa overlap GB:PROTEIN_ID BAB81018.1 LENGTH 277 SQ:AASEQ MKYKMICIDMDGTLLNSKKVVSEENRIALKKAYEKGVHIIICTGRNPKNAIYFSEFLGVNCAVIANNGAWVIDEDKEVIISKDVLDENQCMDIMSICKEYKGVPSFHSRDSVYWPSRFRKYLYDIILNKKIPEKYRVKNIYVKEKEEWREVFKSNNIGKCIIIELNTKKLKKIRENLIKKGNYEITQSGRYALEVNNKGVSKGRAVKALAEEYKIKREEIICIGDNENDLSMITYAGLGVAMGNAIDSLKEKADYITESNDKNGVAKVIYEFVLKND GT:EXON 1|1-277:0| BL:SWS:NREP 1 BL:SWS:REP 4->269|YWTE_BACSU|1e-32|35.7|263/286| PROS 223->245|PS01229|COF_2|PDOC00944| BL:PDB:NREP 1 BL:PDB:REP 3->269|1nf2A|2e-26|31.9|254/267| RP:PDB:NREP 1 RP:PDB:REP 4->270|3dnpA|8e-32|22.7|260/268| RP:PFM:NREP 1 RP:PFM:REP 6->269|PF08282|1e-37|39.4|249/253|Hydrolase_3| HM:PFM:NREP 1 HM:PFM:REP 6->269|PF08282|9e-75|40.5|252/254|Hydrolase_3| RP:SCP:NREP 1 RP:SCP:REP 4->274|1kytA|3e-54|24.4|221/225|c.108.1.10| HM:SCP:REP 1->276|2b30A1|2.8e-69|39.2|260/0|c.108.1.10|1/1|HAD-like| OP:NHOMO 1643 OP:NHOMOORG 518 OP:PATTERN ---------------1-------1----1---1-1-----------1---1111111111-------1 -2---11122211111111-11--12111111-111-11--1-1--1-----1---------1--11111-1----111--1------3341-311----22-2--11-------------------------------1111121-11-11111--------11-1111---------------1--1--1397787877676787775677777784442645A99A9935455555555555555444457B556653769BB44785663347679998656877666656666665666666665665855665344B3318B444444484725225887132611431111111111112223226------------1-1111-1-1111--------------1--1---------------------------------1111111112211------------------------------------------------------------------------------------------------------------------------------------------2----------------------1-1----3241------2---------------------1-------11-34322444444444444-4444444444444334435333343234353445323454544333244431-533333333333-11--------------133344411111222211111-111--------111------111----------2112222221143311---------------5--11--11122221-11-1--3--4447314443442431112212212111-11 2211-1--311--12-----------------------------------------------------------------------22---------------1----2------------------------------------------------------------------11-17222--2111-11121---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 100.0 SQ:SECSTR HcccEEEEccccccccTTccccHHHHHHHHHHHHTTcEEEEcccccHHHHHHHHHHTTccccEEEGGGTEEEccTTcccEEccccHHHHHHHHHHHHTcccEEEEEccccEEEcccccccHHHHHcccccccTTTcHTcccEEEcccHHHHHHccccccEEEEEccGGGHHHHHHHHHHHcTEEEEEEETTEEEEEETTccHHHHHHHHHHHTTccGGGEEEEEccGGGHHHHHHccEEEETTTccHHHHHHccEEcccTTTTHHHHHHHHTcHTcc PSIPRED ccEEEEEEEcccccccccccccHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccccEEEEccEEEEEccccEEEEEccccHHHHHHHHHHHHHcccEEEEEEcccEEEEcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccccEEEEEcccccHHHHHHHHHHHHcccHHHEEEEEccccHHHHHHHcccEEEEccccHHHHHHHHHHHHcccccHHHHHHHHHHHccc //