[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1359
DDBJ      :CPE1359      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   83->117 PF05808 * Podoplanin 0.00011 41.2 34/162  
:HMM:PFM   8->80 PF08264 * Anticodon_1 0.0009 20.0 70/152  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81065.1 GT:GENE CPE1359 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1603308..1603748) GB:FROM 1603308 GB:TO 1603748 GB:DIRECTION - GB:GENE CPE1359 GB:PRODUCT hypothetical protein GB:NOTE 146 aa, no significant homology 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB81065.1 LENGTH 146 SQ:AASEQ MKKLHEENIKNFKKRKEIDKIYEDVSNYYLKRLEKGTLDFSKERLLLESEKTYYDSPAANNLVTIFITMMITPFTPEIIEVLKNVFKDGVNLVSTLVGIIIVGFWAMIIVPGVISIIRSFANMHKSYKDRSLYYSICIDVLEKLEN GT:EXON 1|1-146:0| TM:NTM 2 TM:REGION 60->82| TM:REGION 95->117| SEG 64->76|tifitmmitpftp| HM:PFM:NREP 2 HM:PFM:REP 83->117|PF05808|0.00011|41.2|34/162|Podoplanin| HM:PFM:REP 8->80|PF08264|0.0009|20.0|70/152|Anticodon_1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //