[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1378
DDBJ      :CPE1378      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  26/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:303 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   12->254 PF04018 * DUF368 2e-19 36.7 %
:HMM:PFM   12->272 PF04018 * DUF368 2.8e-66 37.1 245/258  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81084.1 GT:GENE CPE1378 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1629448..1630359) GB:FROM 1629448 GB:TO 1630359 GB:DIRECTION - GB:GENE CPE1378 GB:PRODUCT conserved hypothetical protein GB:NOTE 303 aa, similar to gpu:AE004347_10 conserved hypothetical protein from Vibrio cholerae (308 aa); 28.4% identity in 271 aa overlap. 8 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81084.1 LENGTH 303 SQ:AASEQ MYVINFIRGFLMALADSVPGVSGGTIAFIMGFYNKFISSLNALTSTKKTDVSKKDAIIFLLKLGIGWITGMVLSILFIASIFDKEIYKISSLFTGFIIFSIPIIISEDKESLKKNYGYIIYAILGIAIVAAITYFNPATGSAKGTSLVLNEFSLPLALYVFFAGMIAISAMVLPGISGSTLLLIFGLYAPVVNGVKEVLTFNFSYLPMLMVFGLGVVVGIITTIRLIKFLLSNYRSQMIYFIIGLMIGSIYAVFMGPTTLEIPKAAMNLSSFNFLFFIIGGALILGLQQLKGYLEKKEKVSNI GT:EXON 1|1-303:0| TM:NTM 8 TM:REGION 12->34| TM:REGION 57->79| TM:REGION 87->108| TM:REGION 116->138| TM:REGION 161->183| TM:REGION 206->228| TM:REGION 237->259| TM:REGION 270->292| SEG 44->55|tstkktdvskkd| SEG 96->106|fiifsipiiis| SEG 116->132|ygyiiyailgiaivaai| SEG 206->227|lpmlmvfglgvvvgiittirli| SEG 274->290|flffiiggalilglqql| RP:PFM:NREP 1 RP:PFM:REP 12->254|PF04018|2e-19|36.7|221/241|DUF368| HM:PFM:NREP 1 HM:PFM:REP 12->272|PF04018|2.8e-66|37.1|245/258|DUF368| OP:NHOMO 27 OP:NHOMOORG 27 OP:PATTERN ---------------------------------------------1---------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------1-----------11111111111111-111-----------------------------------------------------------------------------------1-1-----111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 298-303| PSIPRED ccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccHHHEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //