[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1411
DDBJ      :CPE1411      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:85 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->47 3be3B PDBj 2e-05 41.7 %
:RPS:PDB   12->75 3be3B PDBj 2e-19 35.0 %
:RPS:PFM   10->67 PF07866 * DUF1653 7e-13 60.3 %
:HMM:PFM   10->76 PF07866 * DUF1653 1.9e-27 58.1 62/64  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81117.1 GT:GENE CPE1411 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1664307..1664564) GB:FROM 1664307 GB:TO 1664564 GB:DIRECTION - GB:GENE CPE1411 GB:PRODUCT hypothetical protein GB:NOTE 85 aa, similar to pir:E83269 hypothetical protein PA3012 from Pseudomonas aeruginosa (strain PAO1) (124 aa); 58.5% identity in 53 aa overlap GB:PROTEIN_ID BAB81117.1 LENGTH 85 SQ:AASEQ MERNIEKSIGKIFRHFKGDLYLVEGVVTHSESGEKMVLYRALYGECGQFVRPYDMFLEEVPKEKENPTGQKYRFQEFEVKSLNRK GT:EXON 1|1-85:0| BL:PDB:NREP 1 BL:PDB:REP 12->47|3be3B|2e-05|41.7|36/76| RP:PDB:NREP 1 RP:PDB:REP 12->75|3be3B|2e-19|35.0|60/76| RP:PFM:NREP 1 RP:PFM:REP 10->67|PF07866|7e-13|60.3|58/63|DUF1653| HM:PFM:NREP 1 HM:PFM:REP 10->76|PF07866|1.9e-27|58.1|62/64|DUF1653| OP:NHOMO 54 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- ----------------------------------1----------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111--------1-1-----1111-----11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111111-----------------------------1----------1-111------------------------------------1-------1--111-----------------------------------------------------------------------------------------------------------------------------1---1-11---------------111111--1-1-11111-1-1-----111------------------------11----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 60 STR:RPRED 70.6 SQ:SECSTR ###########EEEETTccEEEEEEEEEcTTTccEEEEEEEcccccccEEEEHHHHTcEE####EETTEEEEcEE########## DISOP:02AL 1-5, 83-85| PSIPRED cccccccccccEEEEEEccEEEEEEEEEEcccccEEEEEEEEcccccEEEEEHHHcccccEEcccccccccEEEEEEEEEccccc //