[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1417
DDBJ      :CPE1417      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  430/915 : Eukaryota  57/199 : Viruses  0/175   --->[See Alignment]
c.1.26
:279 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->273 1q7zA PDBj 5e-30 36.7 %
:RPS:PDB   6->275 3bofA PDBj 4e-39 31.7 %
:RPS:SCOP  6->275 1q7mA2  c.1.26.1 * 3e-33 32.6 %
:HMM:SCOP  6->279 1umyA_ c.1.26.1 * 6.4e-67 40.0 %
:RPS:PFM   10->275 PF02574 * S-methyl_trans 1e-29 34.6 %
:HMM:PFM   10->276 PF02574 * S-methyl_trans 5.9e-42 30.2 265/305  
:BLT:SWISS 5->275 YITJ_BACSU 1e-26 29.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81123.1 GT:GENE CPE1417 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1671289..1672128) GB:FROM 1671289 GB:TO 1672128 GB:DIRECTION - GB:GENE CPE1417 GB:PRODUCT hypothetical protein GB:NOTE 279 aa, similar to N-terminal of pir:B72397 5-methyltetrahydrofolate S-homocysteine methyltransferase from Thermotoga maritima (strain MSB8) (768 aa); 36.6% identity in 268 aa overlap GB:PROTEIN_ID BAB81123.1 LENGTH 279 SQ:AASEQ MKNLNLKNGVIIADGAMGTRIMELGVNLKETPSELLNIKKPELIEKIHREYIESGANLILSNTFMCNIINAKRNNYNLEEIIEAGISIAKKACGYHGLVALDIGPLSYYIEENDSSFKEIVYENTERIINASKDKFDLVIFETLGSLKEGEFAVKKAKTLTDKKVICSFTLAYKKDIPNFIKNMVSTLEPLGVDALGINCTGYEEILMALDILKENTNLPIMIKANLGIPKKVGEELVYDKTLEEFKNLSKRALEKGVNIIGGCCGTTPEYIRAICNLK GT:EXON 1|1-279:0| BL:SWS:NREP 1 BL:SWS:REP 5->275|YITJ_BACSU|1e-26|29.7|266/612| BL:PDB:NREP 1 BL:PDB:REP 6->273|1q7zA|5e-30|36.7|259/559| RP:PDB:NREP 1 RP:PDB:REP 6->275|3bofA|4e-39|31.7|265/560| RP:PFM:NREP 1 RP:PFM:REP 10->275|PF02574|1e-29|34.6|263/296|S-methyl_trans| HM:PFM:NREP 1 HM:PFM:REP 10->276|PF02574|5.9e-42|30.2|265/305|S-methyl_trans| GO:PFM:NREP 1 GO:PFM GO:0008898|"GO:homocysteine S-methyltransferase activity"|PF02574|IPR003726| RP:SCP:NREP 1 RP:SCP:REP 6->275|1q7mA2|3e-33|32.6|264/300|c.1.26.1| HM:SCP:REP 6->279|1umyA_|6.4e-67|40.0|270/0|c.1.26.1|1/1|Homocysteine S-methyltransferase| OP:NHOMO 599 OP:NHOMOORG 489 OP:PATTERN ------------------------------------------------------------------11 31311-11111-1-11111-11111111111111111111--------------------111-1111111----------11--11-111111-----1-1-1111--1----------------1---1-1---12211---1111111111111111111111111121111111111111111111-1112222222212222221233222232212-1-1111111211111111111111111111-1-----1-1-12-----1-1-----111-----11------------------------1--111----21133111111111121331111111--1211-1112-111--11121111-1----------1111---1---1---------------------2--1--21-111111-1111--2-1--111-----------11--1------------------------------11---111-11111111----1111-----11111--111111-1-11-11111111-1-----------1111-1--1-1111111--1-2211222221111-22-1-------------------11-11----1-1-1-1121----1-1----1-11-11---1--1-------1--11----------------------------------1----111111111-111111------11--1--------------1---------11-11--1-11---------11111-1111-1------1-------111---------1--1111111-1---1--------------111111111------------------------------------1-111111111-- ----111-21----1------------------------------------------------11----1-1-1--11-1-111-1-----------------111-1--511111--------1--1-271-11----1----------2-----1-13481-11------111-111G-----2--3-31---2--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 273 STR:RPRED 97.8 SQ:SECSTR #####HHHccEEcccccHHHHGGGTcccccccGGGHHHHcHHHHHHHHHHHHTTTccEEEcccTTccHHHGGGTcGGGHHHHHHHHHHHHHHHTHTcEEEEEEcccccTTTcccccHHHHHHHHHHHHHHHHHTTccEEEEEEEccHHHHHHHHHHHHHHccccEEEEEcccccTTcccHHHHHHHHHTccccEEEEEccccHHHHHHHHHHHHHTcccEEEEEccccccEEETTEEEccccHHHHHTTHHHHHHTTccEEcccTTccHHHHHHHHHH# PSIPRED ccccHHHcccEEEEcHHHHHHHHccccccccccHHHccccHHHHHHHHHHHHHHcccEEEcccccccHHHHHHccccHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHccccEEEEccccccccccccEEEcccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHcc //