[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1422
DDBJ      :CPE1422      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  155/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
d.154.1
:325 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->318 2drhB PDBj 3e-06 30.3 %
:RPS:PDB   6->314 2drhB PDBj 8e-22 21.5 %
:RPS:SCOP  6->311 1b65A  d.154.1.1 * 2e-20 22.3 %
:HMM:SCOP  6->321 1b65A_ d.154.1.1 * 4.2e-68 37.7 %
:RPS:PFM   6->316 PF03576 * Peptidase_S58 9e-42 47.6 %
:HMM:PFM   5->314 PF03576 * Peptidase_S58 1.6e-46 29.1 278/326  
:BLT:SWISS 6->129,218->278 Y1368_MYCBO 6e-14 37.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81128.1 GT:GENE CPE1422 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1676773..1677750 GB:FROM 1676773 GB:TO 1677750 GB:DIRECTION + GB:GENE CPE1422 GB:PRODUCT conserved hypothetical protein GB:NOTE 325 aa, similar to sp:YD33_MYCTU HYPOTHETICAL 33.9 KDA PROTEIN RV1333 from Mycobacterium tuberculosis (strain H37RV) (344 aa); 39.2% identity in 316 aa overlap. 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB81128.1 LENGTH 325 SQ:AASEQ MFEIKITDIDGFKLGHAQDFEGATGCTVLLCEEGASGGVDVRGGAPGTRETDLLNPMEMVDKVHAIVLSGGSAFGLDSCSGVMEYLENKNVGFDVGVAKVPIVCGAVLFDLACGNPKIRPNKEMGLEACKNSETYLDSKNGNIGCGTGATVGKALNQKLAMKGGFGSYAVQVGDLKVGAIVGVNSLGDIVDPNNNNKIIAGGLSQDRNSFINIEESLLANYSNPKNVFKGNTTIGCIVTNGDFNKAEANKIASMAQNGFGRTIRPAHTMFDGDTIFTLSSNKVKADINVVGLLAAQVMEKAIIKAVKEADSSYGFLSHKDLKFNV GT:EXON 1|1-325:0| BL:SWS:NREP 1 BL:SWS:REP 6->129,218->278|Y1368_MYCBO|6e-14|37.1|185/344| BL:PDB:NREP 1 BL:PDB:REP 5->318|2drhB|3e-06|30.3|277/353| RP:PDB:NREP 1 RP:PDB:REP 6->314|2drhB|8e-22|21.5|279/353| RP:PFM:NREP 1 RP:PFM:REP 6->316|PF03576|9e-42|47.6|290/307|Peptidase_S58| HM:PFM:NREP 1 HM:PFM:REP 5->314|PF03576|1.6e-46|29.1|278/326|Peptidase_S58| RP:SCP:NREP 1 RP:SCP:REP 6->311|1b65A|2e-20|22.3|273/363|d.154.1.1| HM:SCP:REP 6->321|1b65A_|4.2e-68|37.7|289/367|d.154.1.1|1/1|DmpA/ArgJ-like| OP:NHOMO 170 OP:NHOMOORG 165 OP:PATTERN -------11111111----------------------------------------------------- --1---1111-1-11-111-11111111111111111111-1-----1----1-1--1------111111----------1-1-----------------------------------------------------11111----1-------------------------------------11111---------------------------------2---------2--------------------------------------------------------------------------------------------1----------1-1-1111111-1-1-111-------1-1----1----1--1111-----111111111111111111111111-11111111111-11111111111111211111----111-----------1--1-----------------------------------1----------------------------------------1111---21-----------------------1-----------------------------1----------------------------------------------------------------------------------------------------------------11-----------------1-------------------------------------------------------------------------1--------------------------------------------------1--------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------2------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 314 STR:RPRED 96.6 SQ:SECSTR ####cGGGcTTcEEEEEEEEEccEEEEEEEcccccTTTEEEEEEEEEEccccHHHHHHHcEEcccEEEEEGGGHHHHHHHHHHHHHHHcTTcTTTcTccccccEEEEEccTTTccGGGccccHHHHHHHHHHcccccccccccGGGTTcEETTEEcEETTEEEEEEEEEETTEEEEEEEEEEEccccGGGcccTTccHHHHTTTcccGGGcccTTHHTTTccccTcHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHHTTccccTTTccEEEEEEEEEEEGGGcHHHHHHHHHHHHHHHHHHHHHcccEEcGGGc####### DISOP:02AL 219-220, 222-223| PSIPRED cEEEEEEccccEEEEEEEcccccccEEEEEcccccEEEEEEEcccccccccEEEccccccEEEcEEEEEcccEEHHHHHHHHHHHHHHccccccccccEEEEEcHHHHHHcccccccccccHHHHHHHHHHcccccccccccccccccccHHccccccEEccccEEEEEEEEccEEEEEEEEEEcccccccccccccEEEccccccccccccccHHHHHHccccccccccccEEEEEEEcccccHHHHHHHHHHHHcccccEEcccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcc //