[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1443
DDBJ      :CPE1443      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:206 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   72->182 PF07155 * DUF1393 1.4e-05 19.4 108/169  
:BLT:SWISS 14->192 Y562A_THEMA 6e-06 24.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81149.1 GT:GENE CPE1443 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1701126..1701746) GB:FROM 1701126 GB:TO 1701746 GB:DIRECTION - GB:GENE CPE1443 GB:PRODUCT hypothetical protein GB:NOTE 206 aa, similar to no homology from (410 aa); 28.3% identity in 127 aa overlap. Putative N-terminal signal sequence and 4 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81149.1 LENGTH 206 SQ:AASEQ MKKKLTYDIYFEIIFYILLVAYLIYGIINKDLILLYSTGLTFITLILPRLICKVAKIKLSPFLNFIIVGFIFISMFLAKVNNFYAIPHWDTFLHTVSGILTFILGYMLFLYLNNYKTDNVNSLVIAIFSMIFGIACTAVWEMWEFFTDQTFGLTAQISLFDTMKDIITGSIFPIILAPSLNKFLKGKKNRLFQDLTDFMRENNKRK GT:EXON 1|1-206:0| BL:SWS:NREP 1 BL:SWS:REP 14->192|Y562A_THEMA|6e-06|24.1|170/192| TM:NTM 6 TM:REGION 7->29| TM:REGION 33->55| TM:REGION 59->81| TM:REGION 93->114| TM:REGION 122->144| TM:REGION 163->185| HM:PFM:NREP 1 HM:PFM:REP 72->182|PF07155|1.4e-05|19.4|108/169|DUF1393| OP:NHOMO 42 OP:NHOMOORG 33 OP:PATTERN ----------------------------------------------2--1------------------ ---------------------------------------------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------1222222----------------------1--------------1111-------------------------------------------------------1---1-1111111---111----------22-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 202-206| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccc //