[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1444
DDBJ      :CPE1444      conserved hypothetical protein
Swiss-Prot:Y1444_CLOPE  RecName: Full=UPF0213 protein CPE1444;

Homologs  Archaea  8/68 : Bacteria  329/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.226.1
:93 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->89 1zg2A PDBj 4e-22 53.4 %
:RPS:SCOP  3->77 1ln0A  d.226.1.1 * 1e-11 16.0 %
:HMM:SCOP  1->72 1mk0A_ d.226.1.1 * 6.2e-14 33.3 %
:RPS:PFM   4->68 PF01541 * GIY-YIG 4e-04 43.1 %
:HMM:PFM   1->73 PF01541 * GIY-YIG 1.1e-19 37.0 73/80  
:BLT:SWISS 1->93 Y1444_CLOPE 3e-52 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81150.1 GT:GENE CPE1444 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1701724..1702005) GB:FROM 1701724 GB:TO 1702005 GB:DIRECTION - GB:GENE CPE1444 GB:PRODUCT conserved hypothetical protein GB:NOTE 93 aa, similar to pir:A69742 conserved hypothetical protein yazA from Bacillus subtilis (99 aa); 51.6% identity in 91 aa overlap. S.D. unclear GB:PROTEIN_ID BAB81150.1 LENGTH 93 SQ:AASEQ MNYVYILKCKDESLYTGWTNNLEKRIKAHNNGCGAKYTRGRGPVKLVYFEFFENKREAQSREYYIKKLTRNQKLQLISSKSIKEENYEKEINL GT:EXON 1|1-93:0| SW:ID Y1444_CLOPE SW:DE RecName: Full=UPF0213 protein CPE1444; SW:GN OrderedLocusNames=CPE1444; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->93|Y1444_CLOPE|3e-52|100.0|93/93| BL:PDB:NREP 1 BL:PDB:REP 2->89|1zg2A|4e-22|53.4|88/94| RP:PFM:NREP 1 RP:PFM:REP 4->68|PF01541|4e-04|43.1|65/80|GIY-YIG| HM:PFM:NREP 1 HM:PFM:REP 1->73|PF01541|1.1e-19|37.0|73/80|GIY-YIG| GO:PFM:NREP 3 GO:PFM GO:0004518|"GO:nuclease activity"|PF01541|IPR000305| GO:PFM GO:0005622|"GO:intracellular"|PF01541|IPR000305| GO:PFM GO:0006281|"GO:DNA repair"|PF01541|IPR000305| RP:SCP:NREP 1 RP:SCP:REP 3->77|1ln0A|1e-11|16.0|75/92|d.226.1.1| HM:SCP:REP 1->72|1mk0A_|6.2e-14|33.3|72/97|d.226.1.1|1/1|GIY-YIG endonuclease| OP:NHOMO 339 OP:NHOMOORG 337 OP:PATTERN ------------------------11111111------------------------------------ --------------------------------------------------------------1----------------111-------------------1-1----1---------------1-----1---------------1----------------1-----------------------------111111-111-11111111111111---11111111111--111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111-21-1111111111111111111---11--1--1111-111-----------------------1----11-1-111111-1-11---------------------------------------------------------------------------------------1--1------11111111111111111-111111-11111-------------------1---------------1--1-1-1--11----11111-1-1-11---1---------------------1---1-------1111--1111111111111111111-------------1-11-1-1111111111-1111111111111111111----111-1111111111111111-1111111-----------------1-----11-1--2-1--------------------------1--------------------------111------------1111111111-------1-----------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 88 STR:RPRED 94.6 SQ:SECSTR #EEEEEEEcTTccEEEEEEccHHHHHHHHHHHTTccccccccccEEEEEEEEccHHHHHHHHHHHHHccHHHHHHHHHHTTcHHHHccc#### DISOP:02AL 92-94| PSIPRED cEEEEEEEEccccEEEEEEccHHHHHHHHHcccccccccccccEEEEEEEEcccHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHccc //