[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1479
DDBJ      :CPE1479      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:211 amino acids
:PSIPRED
:HMM:PFM   87->169 PF00615 * RGS 0.0009 20.5 73/118  
:HMM:PFM   27->99 PF03378 * CAS_CSE1 0.001 19.1 68/435  
:BLT:SWISS 88->139 KAD_UREU1 7e-05 36.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81185.1 GT:GENE CPE1479 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1734415..1735050) GB:FROM 1734415 GB:TO 1735050 GB:DIRECTION - GB:GENE CPE1479 GB:PRODUCT hypothetical protein GB:NOTE 211 aa, no significant homology GB:PROTEIN_ID BAB81185.1 LENGTH 211 SQ:AASEQ MSLFLGKIHFWLFDKIKWFENLEEEVLKIAKERNMPVEEWISYANLNFGEKTPNKPLDEIIDESNIHGWLEGRINSAESRCAYYITNMLKEDSEVKKELIELYENHGKINADECKGQIDGENILEVYNSLNDYILDGMPCDRINEILENSSEKIVWHMSRDLHERFWESVGGDVNEFHDLRNSWIKAFVKEINPKLELVIYEDGLKAIVRK GT:EXON 1|1-211:0| BL:SWS:NREP 1 BL:SWS:REP 88->139|KAD_UREU1|7e-05|36.5|52/213| HM:PFM:NREP 2 HM:PFM:REP 87->169|PF00615|0.0009|20.5|73/118|RGS| HM:PFM:REP 27->99|PF03378|0.001|19.1|68/435|CAS_CSE1| OP:NHOMO 24 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111112121----11111-11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHccHHHccccEEEEEEEccccHHHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHcc //