[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1483
DDBJ      :CPE1483      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81189.1 GT:GENE CPE1483 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1738200..1738394) GB:FROM 1738200 GB:TO 1738394 GB:DIRECTION - GB:GENE CPE1483 GB:PRODUCT hypothetical protein GB:NOTE 64 aa, similar to gpu:AE004172_2 hypothetical protein from Vibrio cholerae (63 aa); 36.1% identity in 61 aa overlap GB:PROTEIN_ID BAB81189.1 LENGTH 64 SQ:AASEQ MDIGNYREMDPYMLLSIINLKLRDCYSDIESLCDDLGIEKDIIGQRLKDCGYIYNRENNQFVAE GT:EXON 1|1-64:0| OP:NHOMO 12 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------111-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------1-1----1111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 62-64| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHcHHccccccc //