[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1487
DDBJ      :CPE1487      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  83/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:334 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   39->324 3hn0B PDBj 2e-22 30.7 %
:RPS:PDB   39->273 1dtzA PDBj 2e-14 9.6 %
:RPS:SCOP  72->331 2nxoA1  c.94.1.1 * 1e-20 17.3 %
:HMM:SCOP  37->270 1xs5A_ c.94.1.1 * 6.6e-25 25.2 %
:RPS:PFM   74->275 PF02621 * DUF178 2e-13 31.4 %
:HMM:PFM   66->269 PF09084 * NMT1 6e-14 24.4 193/216  
:HMM:PFM   1->26 PF08085 * Entericidin 0.0005 50.0 22/42  
:HMM:PFM   238->312 PF01540 * Lipoprotein_7 0.001 21.3 75/353  
:BLT:SWISS 66->291 YTLA_BACSU 9e-12 25.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81193.1 GT:GENE CPE1487 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1741419..1742423) GB:FROM 1741419 GB:TO 1742423 GB:DIRECTION - GB:GENE CPE1487 GB:PRODUCT conserved hypothetical protein GB:NOTE 334 aa, similar to pir:D72405 hypothetical protein from Thermotoga maritima (strain MSB8) (300 aa); 29.7% identity in 266 aa overlap GB:PROTEIN_ID BAB81193.1 LENGTH 334 SQ:AASEQ MKKLNKFLSLVLMVLFSLSILVGCNTSKKEEAKAPEEKTSIEIVVPDGLPAISIVKMIKEKPEIMKGLDINYSIVKGSDALVSKVLKGEGDICIVPSNVAAIAYNKEAKYKLAGTVGFGSLYVISSDDSVNSLEDLKGKDVYNVGQGLTPDLIFKILLQNDGINPEKDLTLSYVNAASELAPLFIEGKAKYAVVPEPMLTQIMTKKPETKIVASLNEQWKEMSDSKMGYPQSSVIVKEDLAKNNSEAVQKILKEIDNSTKWANENKEEAGAFAEEVGITGKKEIIAKSLERANLNYVSALDSESEYIKYYDKIYSLEPKAIGGKKVNEEIFLQK GT:EXON 1|1-334:0| BL:SWS:NREP 1 BL:SWS:REP 66->291|YTLA_BACSU|9e-12|25.8|217/334| TM:NTM 1 TM:REGION 4->24| SEG 8->22|lslvlmvlfslsilv| SEG 28->38|kkeeakapeek| BL:PDB:NREP 1 BL:PDB:REP 39->324|3hn0B|2e-22|30.7|264/277| RP:PDB:NREP 1 RP:PDB:REP 39->273|1dtzA|2e-14|9.6|219/689| RP:PFM:NREP 1 RP:PFM:REP 74->275|PF02621|2e-13|31.4|185/253|DUF178| HM:PFM:NREP 3 HM:PFM:REP 66->269|PF09084|6e-14|24.4|193/216|NMT1| HM:PFM:REP 1->26|PF08085|0.0005|50.0|22/42|Entericidin| HM:PFM:REP 238->312|PF01540|0.001|21.3|75/353|Lipoprotein_7| RP:SCP:NREP 1 RP:SCP:REP 72->331|2nxoA1|1e-20|17.3|237/272|c.94.1.1| HM:SCP:REP 37->270|1xs5A_|6.6e-25|25.2|222/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 98 OP:NHOMOORG 83 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------1---1--------------------11-------------1----------------------------------------------------------------------------------------------11---111111--1-111--1--11-111---------------1-------------------------------------------------------------------------------------------21112221222121-111111121---12---22-1-1---1---------------------------21--2-------------------------------------1---2------------------------------------------------------------------------------------------------------1---------------11-----1--1------------1-----------1---------1-1-----------------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------------------------1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 87.7 SQ:SECSTR ######################################ccEEEEEccHHHHHHHHHHHHHHHTTTccccEEEEEcccHHHHHHHHHTTccccEEEcHHHHHHHHcTTTcEEEEEEEccEEEEEEEEccccccGGGcTTcEEEccTTcTTTTHHHHHHTGGGTccccTTccHHHHHHHGGHHHHHccEEEcTTccTTTcHHHHTTccccGGGTTccTHHHHHHHcTTcTTcHHHHHHHHHHccccHcEEEEETTHHHHHcccHHHHTTEEEEETHHHcTTccHHHHHHHHHHHccHHHHccHHHHcHHHHHHHHHHHHHHHcTTccTTccTT### DISOP:02AL 1-3, 26-36| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHcccEEEEEEcHHHHHHHHHccccEEEEEEccccEEEEEEcccccccHHHHcccEEEEEccccHHHHHHHHHHHHccccHHHcEEEEEEccHHHHHHHHHHccEEEEEEccHHHHHHHHHcccEEEEEEcHHHHHHHccccccccEEEEEEEHHHHHHcHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHccc //