[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1493
DDBJ      :CPE1493      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  387/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
:169 amino acids
:PSIPRED
:RPS:PFM   59->160 PF09335 * SNARE_assoc 2e-08 28.6 %
:HMM:PFM   36->162 PF09335 * SNARE_assoc 1.5e-23 28.1 121/123  
:BLT:SWISS 7->164 APL_LACLA 2e-14 27.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81199.1 GT:GENE CPE1493 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1746252..1746761) GB:FROM 1746252 GB:TO 1746761 GB:DIRECTION - GB:GENE CPE1493 GB:PRODUCT conserved hypothetical protein GB:NOTE 169 aa, similar to pir:B81322 probable integral membrane protein (dedA homolog) Cj1168c from Campylobacter jejuni (strain NCTC 11168) (200 aa); 29.7% identity in 158 aa overlap. Putative N-terminal signal sequence and 3 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81199.1 LENGTH 169 SQ:AASEQ MVVFMTMQDILYYIHTYGLIVLFLIVVGEYCVPAMPTGIVMPAAGIIAGQAHKGIIKVMLISLIAGLVGSIILYLLGYFVGSTLLEKLKIKHPKIEDKLEKTEKILEKHSFLGIFICRLIPIIRTYVSLICGTVKVNFFKFIIFSIPGIFCWNFTGIVVGYFFGGKIRF GT:EXON 1|1-169:0| BL:SWS:NREP 1 BL:SWS:REP 7->164|APL_LACLA|2e-14|27.4|157/214| TM:NTM 4 TM:REGION 22->44| TM:REGION 60->82| TM:REGION 110->132| TM:REGION 142->164| RP:PFM:NREP 1 RP:PFM:REP 59->160|PF09335|2e-08|28.6|98/119|SNARE_assoc| HM:PFM:NREP 1 HM:PFM:REP 36->162|PF09335|1.5e-23|28.1|121/123|SNARE_assoc| OP:NHOMO 496 OP:NHOMOORG 408 OP:PATTERN -------111111111---------------------------21----1-----------1-1---1 111--11-221211-------1---1------------11--1-11-1111-1--2----22-1211-12--1112221111----11--211111---------112-1---------------11111--1-11111-----1---11--1--11-------1-2111---11-----1--1-1-----1-1111111111111111--1111111--1111-333333-121111111111111131112-111-1-12111122---221-1121--------11----------------------------------1--11-----111-12111-5661----1--1122------112121----11-------------------1---------------------------------------------1-------111111111--1-----------------------------------1-1--111-111-11-------1------11111--111--------------11-1111211111111-----11-------11---111111111-11111--111211122221--1-------112----11----------------------2------------------1---1-11111111111-1111111111111111111111111--1111111111111111211111111-111111111111--1-111111111-----111--------1---111111211-1-1111-1-1--1-1----122222222-------------------------------------------------------------------------------------111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111D11----------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //