[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1495
DDBJ      :CPE1495      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->30 PF11239 * DUF3040 0.00083 53.3 15/82  
:BLT:SWISS 21->59 TTCA2_FRAP2 8e-05 38.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81201.1 GT:GENE CPE1495 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1747807..1748061) GB:FROM 1747807 GB:TO 1748061 GB:DIRECTION - GB:GENE CPE1495 GB:PRODUCT hypothetical protein GB:NOTE 84 aa, no significant homology GB:PROTEIN_ID BAB81201.1 LENGTH 84 SQ:AASEQ MSGVAGEGCEILVPFNERRPLAEIERSLVKTYRKQVWSKFIKAIKDYKLVEEGDKISYCYFRRKRFFNNGKAFSRVKKTWSNKL GT:EXON 1|1-84:0| BL:SWS:NREP 1 BL:SWS:REP 21->59|TTCA2_FRAP2|8e-05|38.5|39/266| HM:PFM:NREP 1 HM:PFM:REP 16->30|PF11239|0.00083|53.3|15/82|DUF3040| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11111111111-111-1111--11---------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 4-6, 82-84| PSIPRED cccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHcccc //