[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1496
DDBJ      :CPE1496      conserved hypothetical protein
Swiss-Prot:Y1496_CLOPE  RecName: Full=UPF0237 protein CPE1496;

Homologs  Archaea  16/68 : Bacteria  98/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.18
:89 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->85 1zpvC PDBj 5e-11 38.8 %
:RPS:SCOP  3->83 1zpvA1  d.58.18.7 * 1e-16 38.8 %
:HMM:SCOP  1->84 1zpvA1 d.58.18.7 * 3.3e-18 33.7 %
:HMM:PFM   4->62 PF01842 * ACT 9.2e-12 25.9 58/66  
:BLT:SWISS 1->89 Y1496_CLOPE 3e-38 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81202.1 GT:GENE CPE1496 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 1748260..1748529 GB:FROM 1748260 GB:TO 1748529 GB:DIRECTION + GB:GENE CPE1496 GB:PRODUCT conserved hypothetical protein GB:NOTE 89 aa, similar to pir:D81059 conserved hypothetical protein NMB1653 from Neisseria meningitidis (group B strain MD58) (90 aa); 45.5% identity in 88 aa overlap GB:PROTEIN_ID BAB81202.1 LENGTH 89 SQ:AASEQ MNAVITVVGKDKVGIIHGVSGILNENNVNILNISQTIMDGYFTMIMLTDISNSTKDISSLKEIFKEFSLKNSLDISVQHEDIFNSMHRI GT:EXON 1|1-89:0| SW:ID Y1496_CLOPE SW:DE RecName: Full=UPF0237 protein CPE1496; SW:GN OrderedLocusNames=CPE1496; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->89|Y1496_CLOPE|3e-38|100.0|89/89| SEG 22->33|ilnennvnilni| BL:PDB:NREP 1 BL:PDB:REP 3->85|1zpvC|5e-11|38.8|80/84| HM:PFM:NREP 1 HM:PFM:REP 4->62|PF01842|9.2e-12|25.9|58/66|ACT| RP:SCP:NREP 1 RP:SCP:REP 3->83|1zpvA1|1e-16|38.8|80/83|d.58.18.7| HM:SCP:REP 1->84|1zpvA1|3.3e-18|33.7|83/0|d.58.18.7|1/1|ACT-like| OP:NHOMO 115 OP:NHOMOORG 114 OP:PATTERN ------------------1----------------11111111--111--1111-------------- ------1-1-111----------------------------------------------------------1111111---1-----------------------------------------------------------------------------------------------------------------------------------------------111111-------------------------1--11----------1-1-1111----11111111111111111-------------11-11111111--11-------1-11111111-1-11--111111111-1-111--1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111111----------------------------11---------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-1--------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 89.9 SQ:SECSTR ##EEEEEEEcccTTHHHHHHHHHHHTTcEEEEEEEEEETTEEEEEEEEc###ccccHHHHHHHHHHHHHHTTEEEEEEEGGGGTc#### DISOP:02AL 89-90| PSIPRED cEEEEEEEccccccHHHHHHHHHHHcccEEEEEHHHHcccEEEEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHcc //