[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1498
DDBJ      :CPE1498      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  105/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->157 PF06177 * QueT 3e-20 48.4 %
:HMM:PFM   9->158 PF06177 * QueT 2.6e-52 44.3 149/152  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81204.1 GT:GENE CPE1498 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1750111..1750614) GB:FROM 1750111 GB:TO 1750614 GB:DIRECTION - GB:GENE CPE1498 GB:PRODUCT hypothetical protein GB:NOTE 167 aa, no significant homology Putative N-terminal signal sequence and 4 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB81204.1 LENGTH 167 SQ:AASEQ MTDKNIKRIVISALIAALYATLTIALAPISYLGVQFRISEIMVLLAFYKKDYIVGLTLGCFIANILGPNGTIDIVLGTFATFISVWGIYLTGKYIKGKKAIWIASIWPTIFNGIIIGWMLNYVYGLPLVLSMGQVALGEFVIITVIGVPVFNFINKKYFGKLNIITR GT:EXON 1|1-167:0| TM:NTM 5 TM:REGION 9->31| TM:REGION 51->70| TM:REGION 72->93| TM:REGION 100->122| TM:REGION 130->152| SEG 13->27|aliaalyatltiala| RP:PFM:NREP 1 RP:PFM:REP 28->157|PF06177|3e-20|48.4|126/152|QueT| HM:PFM:NREP 1 HM:PFM:REP 9->158|PF06177|2.6e-52|44.3|149/152|QueT| OP:NHOMO 108 OP:NHOMOORG 107 OP:PATTERN ----1-----------------------------------------------------------1--- ------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------11----111111111111111------11111121--111111----------------------1-----------------11---1------111-11111111111111111111111111111111111--1111111111111111--111111-1--11---------1-1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHEEHHHHHHHHHEEccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEc //