[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE1503
DDBJ      :CPE1503      conserved hypothetical protein
Swiss-Prot:Y1503_CLOPE  RecName: Full=UPF0045 protein CPE1503;

Homologs  Archaea  1/68 : Bacteria  80/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.48
:95 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   6->95 1vk8A PDBj 5e-19 48.3 %
:RPS:PDB   1->95 2ekyG PDBj 2e-09 26.6 %
:RPS:SCOP  7->95 1yqhA1  d.58.48.1 * 3e-30 48.3 %
:HMM:SCOP  2->95 1vk8A_ d.58.48.1 * 9.9e-26 39.8 %
:RPS:PFM   23->91 PF01910 * DUF77 2e-08 41.2 %
:HMM:PFM   6->94 PF01910 * DUF77 7.2e-31 39.3 89/92  
:BLT:SWISS 1->95 Y1503_CLOPE 1e-50 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB81209.1 GT:GENE CPE1503 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(1755260..1755547) GB:FROM 1755260 GB:TO 1755547 GB:DIRECTION - GB:GENE CPE1503 GB:PRODUCT conserved hypothetical protein GB:NOTE 95 aa, similar to sp:YVI2_CLOPE HYPOTHETICAL 10.7 KDA PROTEIN IN VIRR 5'REGION (ORF2) from Clostridium perfringens (95 aa); 100% identity in 95 aa overlap GB:PROTEIN_ID BAB81209.1 LENGTH 95 SQ:AASEQ MDTCNVSLQILPSVEDSRLYEVVDKVIEYIESTGVKFEVGPMETTMEGKIDDLLEIVKKSQEICIEEGAGRVISIVKIDYKKGGVTMDEKVGKYR GT:EXON 1|1-95:0| SW:ID Y1503_CLOPE SW:DE RecName: Full=UPF0045 protein CPE1503; SW:GN OrderedLocusNames=CPE1503; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->95|Y1503_CLOPE|1e-50|100.0|95/95| BL:PDB:NREP 1 BL:PDB:REP 6->95|1vk8A|5e-19|48.3|87/91| RP:PDB:NREP 1 RP:PDB:REP 1->95|2ekyG|2e-09|26.6|94/96| RP:PFM:NREP 1 RP:PFM:REP 23->91|PF01910|2e-08|41.2|68/92|DUF77| HM:PFM:NREP 1 HM:PFM:REP 6->94|PF01910|7.2e-31|39.3|89/92|DUF77| RP:SCP:NREP 1 RP:SCP:REP 7->95|1yqhA1|3e-30|48.3|89/101|d.58.48.1| HM:SCP:REP 2->95|1vk8A_|9.9e-26|39.8|93/0|d.58.48.1|1/1|MTH1187/YkoF-like| OP:NHOMO 81 OP:NHOMOORG 81 OP:PATTERN ---------------------------------------------------------1---------- ---------------------------------------------------------------------------------1-----------------------1------------------------------11111-----------------------------------------------------11111111111111111----111--------------1----1-----------1111----11-------------11-1-------------11111111111--------------------------1-1111111-11-111-1111-1-------11-1------111---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1-------------------------------------------------------------------1-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 95 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEEEEEccccccHHHHHHHHHHHTTcccEEEEccccEEEEEEHHHHHHHHHHHHHHHHHTTccEEEEEEEEEcccccccHHHHHHHTT PSIPRED ccEEEEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEcccccEEEccHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccHHHHHHHcc //